CAZyme Information: H310_03772-t26_2-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_03772-t26_2-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		59862.14	6.8628

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913957:35165-36934(-)

Full Sequence      

MGTWMSSPMEHKNTSPPDPTLFAATDALKAFISPTNVSLDKACGPVPTNKWWGNLLSCNA
AGRLDPVYPSPYTVCIDNIAATIACSYLYDCMHQGPINVNGAISYYFFPRCCHLLFHCDA
PGVRFFVEDWDDLTVQVALTDGKTQFLRSVMALGQAFMTIQHSNVPICLSSECAIVSVNG
QLIAEGFVYKGRSDAGKLVLGLNNGQRWLLCWSSCASDALTFTFTNQTLKSSAAFNGIVQ
AAIVPSDEALTVLEQYAGGYVHRGQVTLDSVHGFHYKWVIQPPTAKSALHFVLEHHKTLL
TFHTQAVNLMVHSHTRGPMHAYTIEHGTSWNFAFSPDEEEKVAACAQFDPPRDPSVQDVI
DNRVVDILRAEVDAATWVMPPGYYFRGKALQKYGSMCLLAAKLAQFKELEPLGIGSIAST
ALTKFKGLLDTLTTPSVEFPLVYDQVYKGIITSEGFAKHDVHVEFGNAVYNDHHYHYGYF
IMGKACDDLDGSMTDCARSGCHCVSSGRIVHACKHTASRVDSDARARRDERRRRMFSPFS
HV

Enzyme Prediction     

No EC number prediction in H310_03772-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	36	483	7.2e-64	0.6141479099678456

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	3.91e-41	32	485	77	522	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	3.21e-26	33	332	4	305	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
407548	Glyco_hydro81C	6.78e-24	362	485	8	124	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26643.1|GH81	3.56e-76	17	485	20	511
CCA20578.1|GH81	1.75e-73	46	485	206	659
CCA20582.1|GH81	1.75e-73	46	485	206	659
CCA20580.1|GH81	1.76e-73	46	485	192	645
CCA20581.1|GH81	1.76e-73	46	485	192	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.41e-18	46	485	41	488	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.44e-18	46	485	66	513	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.26e-16	46	485	41	488	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	1.06e-23	45	485	34	470	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	3.09e-20	32	485	68	505	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	2.34e-19	44	485	432	876	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	9.52e-16	140	485	331	667	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	2.27e-14	19	485	438	905	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

There is no transmembrane helices in H310_03772-t26_2-p1.