CAZyme Information: H310_03772-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_03772-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
715		79539.64	6.4400

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913957:34543-36934(-)

Full Sequence      

MGTWMSSPMEHKNTSPPDPTLFAATDALKAFISPTNVSLDKACGPVPTNKWWGNLLSCNA
AGRLDPVYPSPYTVCIDNIAATIACSYLYDCMHQGPINVNGAISYYFFPRCCHLLFHCDA
PGVRFFVEDWDDLTVQVALTDGKTQFLRSVMALGQAFMTIQHSNVPICLSSECAIVSVNG
QLIAEGFVYKGRSDAGKLVLGLNNGQRWLLCWSSCASDALTFTFTNQTLKSSAAFNGIVQ
AAIVPSDEALTVLEQYAGGYVHRGQVTLDSVHGFHYKWVIQPPTAKSALHFVLEHHKTLL
TFHTQAVNLMVHSHTRGPMHAYTIEHGTSWNFAFSPDEEEKVAACAQFDPPRDPSVQDVI
DNRVVDILRAEVDAATWVMPPGYYFRGKALQKYGSMCLLAAKLAQFKELEPLGIGSIAST
ALTKFKGLLDTLTTPSVEFPLVYDQVYKGIITSEGFAKHDVHVEFGNAVYNDHHYHYGYF
IMAVAIAFHLDASYMHANTRLLEWTATLVRDVMSADDACFPRFRTFDWFLGHSMSHGVTC
MVDGKDEESTSEEINCLYACGLWAQVTQNSSLRDVSRVMLKLASLAHRTYFFMSHSNVTH
PPAFRPNKVSGILFENKCDYTTWFSANRECIHGIQMLPVSPVLEYSRPSFFVVEEWNEVL
SKLDLPSTNAWTSLLVANSSVMSARDACKKLQDCAMDDGLSRAYALYFSLTRPSH

Enzyme Prediction     

No EC number prediction in H310_03772-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	36	708	5.7e-145	0.9839228295819936

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	2.25e-113	362	706	8	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	2.26e-111	32	709	77	752	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	7.66e-26	33	332	4	305	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26643.1|GH81	3.89e-164	17	713	20	751
CCA20580.1|GH81	9.42e-155	46	712	192	882
CCA20581.1|GH81	9.56e-155	46	712	192	882
CCA20579.1|GH81	7.18e-154	46	710	206	894
CCA20578.1|GH81	1.31e-143	46	689	206	873

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	4.41e-71	46	713	41	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	6.57e-71	46	713	66	744	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	9.42e-67	46	713	41	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5V1W_A	5.27e-19	471	700	439	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]
5T4A_A	5.48e-19	471	700	459	687	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125],5T4G_A Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	6.91e-69	45	687	34	672	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	5.36e-65	32	709	68	734	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	4.51e-64	44	709	432	1109	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	5.38e-60	140	709	331	899	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q12168|ENG2_YEAST	7.70e-56	40	685	105	746	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

There is no transmembrane helices in H310_03772-t26_1-p1.