CAZyme Information: H310_03044-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_03044-t26_1-p1
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		35158.70	6.4707

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913955:1936635-1937692(+)

Full Sequence      

MLRSFTAAIFAIGLSLTASPASASVGLCATNKPYSYSVAKTQYPHLKSAIEAVEAQPIAT
WYTDRSQDAKTQVQNVVSKCPAGDRPTVVVYGLPNKDCEGHHSSDGSNKSTADYAAFLES
LVAAVGNNDVIYILEPDAIGLLAGGSECAVTNGYEANLIVALGILGKNPRADIYVDVGYW
VLGGQSDAKIAAVLAKLDPTGKRLKGISINTSNFRSTDELVRLCSTFSATAKKTTGLAAT
CVLDISRNFQGPDPNSQWCNPKGRGIGRPPAVHPAAYPLIDYFLWIKPPGESDGTCNGGP
NAGAFFAEGFVDLWNKGYFVSVEGQPQINITTA

Enzyme Prediction     

No EC number prediction in H310_03044-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	39	297	2.9e-56	0.9421768707482994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	9.09e-41	44	301	2	292	Glycosyl hydrolases family 6.
227616	CelA1	1.68e-20	78	313	178	406	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55974.1|GH6	2.26e-141	26	331	24	327
UIZ23635.1|GH6	6.18e-87	33	329	29	323
AIG55947.1|GH6	3.93e-78	16	320	8	301
AIG55492.1|GH6	1.07e-74	12	321	3	302
AIG55792.1|GH6	3.35e-74	10	328	3	310

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UP3_A	8.92e-35	82	313	67	288	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UP0_A	8.92e-35	82	313	67	288	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	1.41e-34	82	313	88	309	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]
1UP2_A	2.43e-34	82	313	67	288	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom [Mycobacterium tuberculosis H37Rv]
1TML_A	8.44e-31	51	313	31	282	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P13933|GUN1_STRSS	3.39e-30	51	298	105	343	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3
sp|P26222|GUN2_THEFU	5.54e-29	51	313	62	313	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|P07984|GUNA_CELFI	2.18e-28	47	308	194	438	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
sp|P26414|GUNA_THEBI	8.59e-25	51	294	65	301	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P33682|GUN1_STRHA	1.96e-22	57	308	69	312	Endoglucanase 1 OS=Streptomyces halstedii OX=1944 GN=celA1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000327	0.999653	CS pos: 23-24. Pr: 0.9705

TMHMM  Annotations     

There is no transmembrane helices in H310_03044-t26_1-p1.