CAZyme Information: H310_02982-t26_2-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_02982-t26_2-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1030		116741.83	7.9882

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913955:1652819-1655911(-)

Full Sequence      

MDEAYQGHATPRESESSSIDAEFVRHRVERPTGNPEAVVDPRMSYQAPVKVTDNNMTQKE
NASSDETVISVHGYMHKQGKRSIKGPIHKSWKKRYFALENAKIYYFQNDADCRRYFSTRN
VDLVVGAVELKEALQLRPSGRLDLPTKGFEIHTKRRVWVLCPETDDEYKMWFEGVEEAIV
SCGAGNVIERHLPNVRKYVMKGLPTYRFLYILFLVAGLVELAGLVLWFVVGVQPCDQARP
TIECPTILSQTMDLLKCGDKPFNGVFTPPKFWLKFAGVEDVKCWAEPPIGQWISYFCLLL
AELISFILGAIYYLGMWKPVRRGAHYLDEFEPKLPDEQWPKVDVFICHYSEPSEETVDTL
AACMNLQYPPHLLHIFILDDGYCKTKWTKGNPVPTIELNKGVIEKAGDLRQEVAQFMYDR
VCDPNDDMELYAWRKLHSSANLPMESRPRVVNRADCAVGSFRDDYRYSGLPHVTFVGRVK
PPTHYSKAGNINNACYNEGANGRYVVILDNDMQPHPKFILATLPFFFDSEDRALKNKYSC
CTGGCNKVARMCCASCKIAGVPEEKISYCSKQCFDNAMHSSSALHRRQVNGTMSEKPNKG
SSKRILYCMTCNNVTNNQGVCKTCMHPTNNPDLEDGLAHSSSPYSDAVKDNAVAFVQTPQ
YFRDCVQFQIGDPLGHRNATFYDAIQTGQDGYDCASFAGTNAIFRREALDSIGGIQYGSL
TEDCYTGQQLCAMGWKGLYFRKDFEGEMSERIRLAEGLIPDNVASSLAQRKRWAKGNFQI
MLMNKKKNYFDKEWTKPKVSVPPKPKSGNFMRKVFYINCTIYPVGSLCALLFFYITLYFL
YTGYAPIYFSGLKLLYALVPKLLIQGALSALSNRTVENNDVVRSQEAWFVYAFTHTTAVL
ETFWWKLTGKEAAWFVTGSSSRGSLTELPNVIVYFGHVFGLVWALIRFFATYNSQQTSHG
ASLLVASLMMGLFIATKLGPSVRMSIQEYFGWSYHSLTDQGNFFGQSMIAFGLVFISLWV
YIEKPSSNPF

Enzyme Prediction     

EC	2.4.1.12:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	644	858	9e-18	0.8730964467005076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	7.42e-46	340	781	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
236918	bcsA	3.15e-17	649	780	366	491	cellulose synthase catalytic subunit; Provisional
133057	CESA_NdvC_like	1.21e-14	649	783	110	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
224136	BcsA	5.23e-13	635	859	153	356	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
404513	Glyco_trans_2_3	1.09e-12	646	783	21	148	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACX56230.1|GT2	0.0	1	1030	10	1033
AEZ51038.1|GT2	0.0	5	1030	8	1025
ABP96907.1|GT2	0.0	3	1030	13	1026
ABP96911.1|GT2	0.0	36	1030	43	1028
ABP96903.1|GT2|2.4.1.12	0.0	3	1030	13	1026

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	2.88e-15	648	783	252	381	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	3.11e-15	648	783	264	393	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	3.12e-15	648	783	265	394	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	6.72e-14	648	846	378	558	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	6.96e-25	471	780	584	764	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|O82859|BCSA2_KOMSB	1.89e-16	648	780	256	382	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|P19449|BCSA1_KOMXY	1.89e-16	648	780	254	380	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|Q9WX61|BCSA3_KOMXY	9.70e-16	648	780	254	380	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|P0CW87|ACSA1_KOMXY	1.66e-14	648	780	254	380	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

Start	End
208	230
292	314
814	836
846	868
931	950
960	982
1003	1022