CAZyme Information: H310_02467-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_02467-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	KI913954|CGC1	39815.57	4.6279

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913954:2854403-2855586(-)

Full Sequence      

MGSGATPDVCMLEETDEAVSRRKLTRLVFSLGVLAFVGGGIAAAVVLAQPSVESSTLTDA
NVNGIHNSTDVSSLSNASDLVLVQDNDTPTIAPSNATNPAPSTSTVVPWTTLTPTEPATT
VGTAPPTTNPPTQVTTTATPTTSAATVAPIQTGLGRILTKDIFLAAFPKANPLYKYESLV
TMAATKYPEFANTGDEVADRREVAAFLGHVSLESGDLRFVEELNKSSMCQASAEFPCAAG
KQYYGRGPMQLSWNYNYKTFGTAAGVDLVANPDLVASDRDLLWWSALWYSNEDKWNGNIH
KAIRRPGGFAYVTYMINGGLECGVNPPNRDSEKSRIASYVKFCNVFGVDPGDNLSCQTGA
FPPTSLWTDDAKHP

Enzyme Prediction     

EC	3.2.1.14:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	156	356	9.9e-56	0.9696969696969697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381595	chitinase_GH19	7.86e-67	158	356	1	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
395130	Glyco_hydro_19	1.77e-49	170	356	21	232	Chitinase class I.
225720	COG3179	1.69e-08	163	320	9	187	Predicted chitinase [General function prediction only].
381610	chitinase-like	4.02e-04	233	317	17	105	chitinase-like domain. This family includes proteins such as chitinases, chitosanase, pesticin, and endolysin, which are involved in the degradation of 1,4-N-acetyl D-glucosamine linkages in chitin polymers and related activities. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Chitosanase enzymes hydrolyze chitosan, a biopolymer of beta (1,4)-linked-D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Pesticin (Pst) is a anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETV63620.1|AA15|GH19	3.47e-113	151	369	333	550
AIG55513.1|CBM1|GH19	2.91e-106	153	367	20	233
ETV82190.1|AA15|GH19	2.35e-99	149	366	395	611
AIG56150.1|GH19	7.10e-99	148	367	11	219
AVH63884.1|CBM50|GH19	1.18e-56	149	356	72	276

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IJ4_A	5.67e-54	158	356	7	205	Crystal Structure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
3WH1_A	2.31e-53	158	356	8	206	Crystal Structure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
2CJL_A	1.76e-48	157	356	2	204	Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
1WVU_A	6.08e-46	155	356	61	265	Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],1WVU_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_A Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_C Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus]
1WVV_A	1.68e-45	155	356	61	265	Chain A, chitinase C [Streptomyces griseus],1WVV_B Chain B, chitinase C [Streptomyces griseus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P21226|CHI2_PEA	2.20e-48	169	358	90	303	Endochitinase A2 OS=Pisum sativum OX=3888 GN=CHI2 PE=1 SV=2
sp|P36361|CHI5_PHAVU	2.06e-45	148	370	69	322	Endochitinase CH5B OS=Phaseolus vulgaris OX=3885 PE=3 SV=1
sp|P06215|CHIT_PHAVU	5.81e-45	148	358	70	311	Endochitinase OS=Phaseolus vulgaris OX=3885 PE=1 SV=1
sp|P19171|CHIB_ARATH	7.28e-44	165	356	105	320	Basic endochitinase B OS=Arabidopsis thaliana OX=3702 GN=CHI-B PE=1 SV=3
sp|Q09023|CHI2_BRANA	1.16e-41	170	356	94	305	Endochitinase CH25 OS=Brassica napus OX=3708 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.925180	0.074835

TMHMM  Annotations     

Start	End
27	49