CAZyme Information: H310_02406-t26_2-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_02406-t26_2-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
836		90449.83	6.5770

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913954:2486306-2488866(-)

Full Sequence      

MRVLVGASMGALAVLGHPAFVDIGVATAKAKAMASSMTIADLLGQMNQIEVGAFTYDDWD
NDGQKTINSSLVEDYAKHNVGAYLNLVPNLAEWGRPLWNASQYRALVATLQDAHVNRSST
RIPILYGFDSTHGANYIANATLFPQPINTGATFNVELAGAVGMYTGRDTLAGGMPWVYSP
MLEVIRHKHWPRMYESYNEDIVAVSELGRAYIAGMQSQGVAACFKHFIGYSDPTDGNDRT
DVVLSKHQVLNYFVPPFKAAIEAGVLSGMGTYVGLNGVPMAANNVTSNLLLRRDLNFSGL
MVTDWGEMYLLHDPRKLVPSELEATAVGMNRTTYDMVMTPHDMSFIKYGRQLVSTGRLAR
ARLEQAVSRILTLKFVLNLFENPLPGADLVDLVGDNASRAAAIVVAQESIVLLKNDDHVL
PLGRPPTTTTTNHTMSLFLTGPSIDNIGLQCGGWSLAWQGIDGNAAFPHGQSIRHAINAT
VRAWNLTAASTDTIAANENGIPRLDHVNVTFLQAMDIYGNFTSNESLQEAIALASTATHT
IVALGERNYAEQFGNSDPQALPPAFVTYVKALATTKTRIILVVVAGRPRILNGLAELCHA
VLWAGLPCEAGGQAIADVLFGRVNPSAKLPFTYPKTDGHVNLATPYYYRSNDVGSTACVR
GGKEFSTDCATEYPFGAGLSYTTFDYTNMQVTPTTLTSDAAAVVVTASVVVTNTGRVAGK
EVVMLFVSPPPSLHNETETRLLKRFAKIWLAPGESTVVRFDITPSDWGFYHNEFGTGLRK
TAPSGSYVVHFKPTTNCADPSTSLCQTVRWENRSGAAAAWNAWHWVVAVLAWVAAL

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	117	337	1.5e-55	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.52e-83	1	770	1	733	beta-glucosidase BglX.
224389	BglX	1.43e-61	37	473	1	387	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	6.17e-50	38	373	1	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	5.38e-39	137	776	108	756	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	2.46e-38	410	681	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	3.95e-189	28	797	28	746
AIG56285.1|CBM13|GH3	8.35e-184	28	797	23	731
AIG55915.1|CBM13|GH3	9.18e-182	28	806	24	743
AIG56284.1|GH3	9.12e-181	29	797	23	726
AIG55676.1|GH3	1.58e-178	30	797	45	753

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	2.09e-106	37	769	24	721	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5XXL_A	5.36e-69	32	789	16	735	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	2.62e-68	32	789	16	735	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5M6G_A	2.53e-64	37	636	58	590	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
5TF0_A	9.35e-63	107	773	68	722	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	3.07e-116	35	789	85	809	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	1.50e-105	37	769	46	743	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|P33363|BGLX_ECOLI	1.52e-64	37	773	45	736	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	7.34e-64	37	773	45	736	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	5.29e-61	111	802	55	717	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.748701	0.251281

TMHMM  Annotations     

There is no transmembrane helices in H310_02406-t26_2-p1.