CAZyme Information: H310_01949-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_01949-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775		85997.77	7.5601

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913954:870991-873318(-)

Full Sequence      

MEHKPMQTMLPTIASHGTFVALAVPKQKRSIFRTSFLLRGMVAVAGVALVVTILQPRQHM
LATNEISNQAAMQSLNCLLDNADASPQCNFPTSAAQSWFAPPRNLHPSIRKDVPIPTNRW
WGNLISSPREDYVPEKRVWTNPYAVVLLSQGVVVSFPYGARYFQGASGNAGGAKSYSHQY
SKDVTIGAITATSHPFQVTSWDDLGVTLRQERAPDQWLQTSLVSGMAYVTAAYSKLPPRI
STTNSIVSLNGKPLVKASKVVGDRFVLGLNNGQQWVVYASSPVTLSVVNDRILQQSNAFT
GHIRVALVRTADDIAAHDKYHGCIVHGGNLTLNQFDYGFQWATSGSCSAGLLHFALAHHA
AILTPDTATPIDSMSRLESATRGAMVPLVTVTTPAQWILAESLVPVELYPRQRPTRERIQ
STRLLAHLKADIDAPWSMPVGGSYYFNGKLAQKYASLCLMASDRAVVGADDSLVRKCQTK
LADVLKPFTTNTFAHRLVYDTVYKGIVTTQGFDEANTYADFGNTIYNDHHYHFGYWVAAA
AITNMVHPTMPGLDELNTRVSFLIRDVANADATDADFPTFRMFDWFKGHSYSHGITAAED
GKDLESTSEDVNFYYAMALFGQATGQRELEHLGRLMLSVNVRSVQMYFLMDSANTIHPPS
IRVNHVPGIYFDNKVHYTTWFSDERKSIHMIQMLPVTPVTEYVRTKQFVQEEWTDILAKL
PVVQEDREHDAALSLLYLNYAAVHPDVAMSKLQTVALDDGLSRSWALYMAASRYT

Enzyme Prediction     

No EC number prediction in H310_01949-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	102	768	1.4e-164	0.9871382636655949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	7.39e-135	428	767	18	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	7.65e-118	85	771	65	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	2.73e-36	106	408	1	314	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55599.1|GH81	1.64e-246	81	773	65	754
AIG56018.1|GH81	3.40e-246	90	773	73	755
AIG56513.1|GH81	4.18e-230	96	773	92	769
UIZ20872.1|GH81	1.62e-202	95	772	100	791
UIZ20875.1|GH81	1.62e-202	95	772	100	791

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.07e-86	92	773	2	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.77e-86	92	773	27	743	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.46e-82	92	773	2	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	7.94e-27	415	764	314	647	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	2.98e-17	423	761	342	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	1.02e-78	90	771	16	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q12168|ENG2_YEAST	9.68e-74	55	767	45	772	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.73e-72	218	771	183	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|D4AZ24|ENG1_ARTBC	2.34e-68	208	775	328	904	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	4.64e-66	114	771	460	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999878	0.000128

TMHMM  Annotations     

Start	End
35	54