CAZyme Information: H310_01704-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_01704-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
937	KI913953|CGC1	104286.14	6.5515

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913953:2867390-2870772(+)

Full Sequence      

MARWMWRWGCWYLAGLSVHVNAAVSVGGSIQSTLASFHRPFLEILTPLNGQVVESSEVDI
ELVVRDYIMPSSFRTYKVCLGIHENTAISSDGASVGVVEFCFDQTSSKQFHVQNLLPGTS
YTVRVVLVDKGTVIAVSMRTFRVAAIAIQGHTENVTILTAMQYALSYQNNLDTDSAMRIY
ESILAEAPGHGHALHLLGLAKYQRGDTMEAIDYIEQALQTNATHEEFHNSLGLCLKDIGR
TAEAATHFETAMSLRPSYIEPRFNLASIWQSTGEYDLAIPVFRAMADKVHSQTLALEYAA
QFDVFVRLCDIYLASKQQNMALECLNEALVLWPNDPTFLNERGNLYLNAGYLDLAEADYK
IAADAGVLISMLNLAITLDASGDTDESINLYSKILAVSEARGLPTGRVLIMRAGVMPRVL
PAEGQLVDLARQAMRRRLDSMLAQDNVTVDSRDPILNAYPTGNYLVSHPYNNKQLKRSLA
QMLQMYCPALKTAAFIPPPSPSIATDLGAVSSTHLELTSMNSLQSDVLPELRRRPRIGFV
SEFYQTQPISHCMHDLVERLNRSQFELFVFAVSTPQSAKLPALTDGVEHVIGLPEGVGPS
ADEIRRHDLDVLVYADVGSDKLSFFLSFANLAPIQAAWGLGHPETTGVPAIDYMVTSEYE
HLSFHDHYTETPFPLKGMGIYLKEPLTPHISTYANSSPDDVRATLTQAFHLPSEYRFYFV
PEPLVNVHPDMDSIVRRILKRDPIGHVFFLTPPKNSKWKHAFTERIKLQPGLPAHRIHLI
IDALDDISTFALLRACDVHLANLYTNKFYHTLEASAAGVPTITLPGELWRSRIPLGLLKH
INVLDTVATTPAEYVQLAVRAASDRSFRHQVVGKLQKYAPKLYGDDEAVHEWARFLQFAV
DKSRRKRKTHANLRALQDNPTHSTNGLAPPTAKDVTL

Enzyme Prediction     

No EC number prediction in H310_01704-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	296	895	4.2e-61	0.6056737588652482

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	5.37e-23	532	875	257	588	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
276809	TPR	1.51e-16	193	283	3	93	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
274350	PEP_TPR_lipo	2.06e-13	167	394	475	695	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
276809	TPR	5.16e-13	162	253	6	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
274350	PEP_TPR_lipo	6.62e-13	164	396	676	899	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20641.1|GT41	3.03e-101	9	899	4	903
BAI76932.1|GT41	4.15e-50	256	904	28	655
QTA91146.1|GT41	2.01e-49	536	904	510	868
QTA90106.1|GT41	3.62e-45	536	900	380	731
AMS33413.1|GT41	6.43e-45	354	904	264	768

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JLB_A	3.56e-07	536	864	207	522	Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2JLB_B Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2VSY_A Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2VSY_B Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2XGM_A Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGM_B Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGO_A XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGO_B XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGS_A XcOGT in complex with C-UDP [Xanthomonas campestris],2XGS_B XcOGT in complex with C-UDP [Xanthomonas campestris]
2VSN_A	3.56e-07	536	864	207	522	Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004],2VSN_B Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O82039|SPY_PETHY	1.85e-11	521	864	476	808	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida OX=4102 GN=SPY PE=2 SV=1
sp|Q8RVB2|SPY_SOLLC	4.89e-10	537	864	490	808	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum OX=4081 GN=SPY PE=2 SV=1
sp|Q96301|SPY_ARATH	2.49e-09	514	864	467	803	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1
sp|P56558|OGT1_RAT	7.75e-09	534	877	545	989	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus OX=10116 GN=Ogt PE=1 SV=1
sp|Q8CGY8|OGT1_MOUSE	7.77e-09	534	877	555	999	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001939	0.998031	CS pos: 22-23. Pr: 0.9649

TMHMM  Annotations     

There is no transmembrane helices in H310_01704-t26_1-p1.