CAZyme Information: H310_01138-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_01138-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
806		90354.95	9.3099

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913953:849207-851961(+)

Full Sequence      

MQLLIPTKQVNKATGAVCPAHAKTKLLARTKAQKSTVMLGGQRTAEKIVSSYVTFNGDLT
PRAKQQLSASELIKRAEKLDYYLQLAYGYAKQIEEMAPIATVSLPLVQQSWDSRRHLPPF
RTSPEFTDMRYTAVRTRDPIKFTHDGYTLRVKELGKDVKVFITITMYNEPSSQLDSTLRG
LANGIAYMCEQHGYDYWQHVVISIVADGRSKINPSMLTYLAKLGLFDKATLVQISMGIAA
EVHLFEATVQLPTATDGMFYPPIQVIFALKESNNGKLHSHLWFFNGFCEQLQPKYTVLVD
VGTIPAETSVYRLIRSMERNPQIGGVAGEIAVDRPQFLNPVIAAQHFEYKIANIMDASLQ
SVFGFIGVLPGAFSAYRYEAIRAIDGEGPLVEYFKSLTSSKKELGLFVGNMYLAEDRILC
FEILARKDCKWTMHYVKDAIASTDVPETLVDLIKQRRRWLNGSFFAGLFAIWNFGRVWRD
TSHSIPRKCIFTLQFTYMALLNVLNWFLLSNLFLAFYYILSLALFYRSPVLLRVTLTVYF
VLVGSLIVFALGNKPGRRTAGFYRASSYIMGLIMLGATAISLYALTGQVHFMDIRPDLVS
CSVADWELPAGAVSSIGLVFLSAFSHGEFSILASTLQYYFMLPTFVNILGIYAYSNLHDL
SWGTKGIDSSSKISGGFTGGTSIKHIVALQLNTANLDVTMEADKHKQSVAAEHEDVDSSF
RVFRSVLLLTWLLSNGAWLYVATSSISCSCYLKYLSFTVATVNIIRFFGALVFLLFRITR
GATRCVEKLYYLSAGECLPRFRPHNV

Enzyme Prediction     

EC	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	166	317	2e-45	0.9938650306748467
GT2	295	546	9e-21	0.4629981024667932

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	9.07e-77	162	466	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
396286	Chitin_synth_1	2.10e-54	166	317	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
224136	BcsA	5.66e-28	260	589	109	411	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	4.11e-17	295	461	204	372	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133045	CESA_like	2.50e-16	265	386	55	171	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACA49151.2|GT2	0.0	1	802	1	798
ADE62521.1|GT2	1.46e-292	66	780	192	903
AAC49743.1|GT2|2.4.1.16	2.60e-239	74	728	157	789
ADE62520.1|GT2	6.48e-167	63	776	145	848
AGT99185.1|GT2	2.07e-150	74	797	146	865

PDB Hits     

H310_01138-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48017|CHS_SAPMO	4.62e-240	74	728	157	789	Chitin synthase OS=Saprolegnia monoica OX=37553 GN=CHS PE=3 SV=1
sp|J9VGT6|CHS8_CRYNH	3.48e-128	119	781	332	1031	Chitin synthase 8 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS8 PE=3 SV=2
sp|P30597|CHS1_SCHPO	5.30e-127	119	781	148	858	Chitin synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chs1 PE=3 SV=2
sp|P87073|CHS1_PHYB8	1.12e-123	119	781	128	841	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1
sp|P30595|CHS2_RHIOL	6.57e-123	119	781	145	858	Chitin synthase 2 OS=Rhizopus oligosporus OX=4847 GN=CHS2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

Start	End
459	478
498	520
530	552
565	587
629	651
722	744
754	776