CAZyme Information: H310_00965-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_00965-t26_1-p1
• CAZy Family: GH1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464	KI913953|CGC3	50312.16	10.5175

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913953:402023-403839(+)

Full Sequence      

MVSAARASKLVYVVAGEASGDAIGGKLIRALQRRHGDGPFQFRGVGGPQMTAAGNFSSLF
PMQELSVMGLVEVLPRVLAIKRRHRHVVEDIKTSQPDAIVTIDSKGFCFRVLKTLQSERN
STGRCPAIVHYVAPSIWAFKHKYRKAASTASSLRQFMDHMLVLLPFEGPLFNQGHAAAPW
TTFVGHPSVEAFLDSHNLFRQHKLTASKAHTAISARFGAREWLPERPGDTVLAAQAAIFH
QARLSGRQNSLERGEFVIAALVGSRENEVRRTIGLVKAAVASFAHDKNVQVHVVFPTIPS
IASLLHQSLHGWAIPHTISVQVEAKTSVLQTSNVALAVSGTVVIESLLAGTPTIVIYRAN
WFTEMIATALARVKFVTLPNILVEQEIVPELIFSKCTRANIANALTNAFKAGTIPDPSND
VLVSAALSQLVPWTVDKSSVTPCRGSDLAAAVVVHEMNKKAQMT

Enzyme Prediction     

No EC number prediction in H310_00965-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	11	410	1.1e-89	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
234580	lpxB	2.61e-85	8	405	1	335	lipid-A-disaccharide synthase; Reviewed
223834	LpxB	1.39e-84	9	405	2	338	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
397004	LpxB	9.33e-67	11	405	1	335	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
167141	lpxB	9.55e-36	12	395	230	554	lipid-A-disaccharide synthase; Reviewed
237606	PRK14089	1.13e-22	33	404	21	312	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCQ73974.1|GT19	1.48e-59	10	405	6	339
AHJ66095.1|GT19	1.33e-56	10	407	5	339
AFK53607.1|GT19	1.44e-56	10	454	8	386
APH59785.1|GT19	4.05e-56	10	407	5	339
URK18835.1|GT19	4.52e-56	11	411	12	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.74e-23	11	405	9	341	Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	5.05e-23	11	405	9	341	Lipid A Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0BS63|LPXB_GRABC	3.69e-55	10	407	5	339	Lipid-A-disaccharide synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=lpxB PE=3 SV=1
sp|B6IST7|LPXB_RHOCS	1.80e-53	10	460	5	386	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
sp|Q2W4D7|LPXB_MAGSA	1.12e-50	10	405	2	338	Lipid-A-disaccharide synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=lpxB PE=3 SV=1
sp|Q5LSU1|LPXB_RUEPO	2.83e-50	6	405	12	359	Lipid-A-disaccharide synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=lpxB PE=3 SV=1
sp|F4IF99|LPXB_ARATH	3.93e-47	11	405	42	399	Probable lipid-A-disaccharide synthase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LPXB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000000

TMHMM  Annotations     

There is no transmembrane helices in H310_00965-t26_1-p1.