CAZyme Information: H310_00776-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_00776-t26_1-p1
• CAZy Family: CBM48
• CAZyme Description: hypothetical protein, variant 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
709		77719.23	8.6193

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913952:2551056-2553429(-)

Full Sequence      

MTRWSVAAVGAAAMIAYSNTTFSHFAWDDRGAILTNMDVRTDVTPIQSILYHDFWGMNLT
SPHSHKSFRPVTVASFRLNYAIHGLHPHGYHLVNVLLHGVVSMLVVRTGQALCVDNSETM
APLFGGLLFAVHPIHCDSVASVVGRSDILCAVFSLLALLSYHQGLLCRHQSKRRQHTWTL
FAVASICLATLAKESGFAMFAVLVAMEYTKHCGVGALRRSGGVMAAGAAFFAWRVWMNGP
SMMYQWSIYENEFAHLPSTTAKALSYAHVHSLYLWKLFWPRHLCYDYGWKTIDAVTSVND
VRNFGSAVAYVCVLTCVIVSAAHRQTSPVFVMLALGICPFVPASHVLFPVGTIVAERLLY
LPSVGFCLVVGWVVDIAMQAANPAAKVHVLSLVGLVLIAATMRTATRNLDWYDEATLFQS
ALHVAPTSVKVLSNLGKVTLPKNATLAALYLEHAVTLMPTYALAHLNLAACYSALKQPLH
AMHHLVHSIELVPNVKAHISLGQHLVEFWESHVGVGDSTLNTAARLIRHAIDQGAACPSA
FYGHAKVAFAHGNIDDTLRSLAKTKQANAHVAARGYDLNEAVDPCLVDTLTGLAWERSNL
TAAVLFYGRVMRLPTFLDCVSVVNNAAASLHRYGRTVDAVALLEAATVRHPLHAVLWSNA
GYMAESLGRHDDSLMFFETALQLQPDSPHVRTKVELIKARRHQLLVKKH

Enzyme Prediction     

EC	2.4.1.109:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT105	78	211	2.7e-33	0.9236641221374046

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400627	DUF1736	4.92e-13	245	314	5	74	Domain of unknown function (DUF1736). This domain of unknown function is found in various hypothetical metazoan proteins.
276809	TPR	1.15e-07	412	490	17	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
274350	PEP_TPR_lipo	2.95e-07	404	690	500	806	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
276809	TPR	1.11e-06	429	507	1	81	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	1.30e-05	624	690	5	71	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAF83034.1|GT105|2.4.1.109	2.11e-65	4	449	21	502
Q5T4D3|GT105|2.4.1.109	2.91e-65	4	449	21	502
BAC25886.1|GT105	2.33e-63	4	437	20	490
CAD7262601.1|GT105	3.59e-63	17	496	19	514
BAC32288.1|GT105	2.43e-62	4	437	20	490

PDB Hits     

H310_00776-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5T4D3|TMTC4_HUMAN	5.17e-66	4	449	21	502	Protein O-mannosyl-transferase TMTC4 OS=Homo sapiens OX=9606 GN=TMTC4 PE=1 SV=2
sp|Q8BG19|TMTC4_MOUSE	4.32e-63	4	437	20	490	Protein O-mannosyl-transferase TMTC4 OS=Mus musculus OX=10090 GN=Tmtc4 PE=2 SV=1
sp|Q8BRH0|TMTC3_MOUSE	2.50e-59	17	533	25	563	Protein O-mannosyl-transferase TMTC3 OS=Mus musculus OX=10090 GN=Tmtc3 PE=1 SV=2
sp|Q6ZXV5|TMTC3_HUMAN	6.06e-59	17	533	20	558	Protein O-mannosyl-transferase TMTC3 OS=Homo sapiens OX=9606 GN=TMTC3 PE=1 SV=2
sp|Q7K4B6|TMTC3_DROME	3.96e-54	12	500	43	586	Protein O-mannosyl-transferase Tmtc3 OS=Drosophila melanogaster OX=7227 GN=Tmtc3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.690236	0.309774

TMHMM  Annotations     

Start	End
5	27
178	200
215	237
304	323
329	351
358	380