CAZyme Information: H310_00646-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_00646-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509		55823.00	7.1520

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913952:2070463-2071992(-)

Full Sequence      

MVSASDRAAAPSLSKMPPSELHTTHDTSAVVTSSSAIVTIAPDVEYKGPMDTTDLTHRRR
KTRLLQALAAGLLVVGAVVGALMISSSLREMASAKDIAVSAGGNDVSVCYDSYDSRNMPD
HFRRIKERFGAVRTFQTQGAFNHIEVAAQSGLQIYAGIWIQSGNIEGDMAAAVYGAKKYP
GTVKAILVGNEELLIGISAGFVIEKINRMKQLLREAGVWNVPVGSVQTDGSWFANPGLAD
ACDVMGVNIHPFFGGSDVSRSRPIEDLKVRWQNIINRFGSYKKVVVTETGWPTSGGAVNG
HVPSSDIARQFINDMRDWAAAGNGGDMPAYFMFHDNPTKNMDFEKAFGLAWSNGAWKFDF
NGAQQPRPPSEIKGVVFVNKANDKVLAAAPNRAVEFHARWGNDWVWDWASQWTIRGPLVV
TWDAANKVDLCLDAYQPWNGGAVHLWPCDANNGNQKWAYDGNTKQLRHATHNGFCLDMAN
PAGGTPHLWSCHDPWVSWVTLQQFEWWTK

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.99e-25	132	318	79	272	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	7.02e-15	429	493	54	119	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	1.25e-11	429	492	11	74	Ricin-type beta-trefoil lectin domain.
238092	RICIN	2.77e-11	425	507	6	83	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
238092	RICIN	9.21e-11	429	492	52	115	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55518.1|CBM13|GH17	1.76e-111	108	499	22	402
AIG55595.1|CBM13|GH17	8.33e-96	106	504	18	556
AIG56197.1|CBM13|GH17	6.10e-93	96	505	24	548
AIG55519.1|CBM13|GH17	7.04e-92	106	504	18	549
AIG56231.1|CBM13|GH17	7.84e-85	106	472	18	367

PDB Hits     

H310_00646-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUT0|EGLC_EMENI	1.97e-11	144	315	77	266	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1
sp|A1C499|BTGE_ASPCL	5.30e-10	129	349	340	554	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|Q0CI96|BTGC_ASPTN	5.88e-10	136	349	399	633	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgC PE=3 SV=2
sp|Q2UUZ1|EGLC_ASPOR	7.72e-10	137	315	70	266	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|A2QH21|EGLC_ASPNC	4.16e-09	132	315	65	266	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000005

TMHMM  Annotations     

Start	End
64	86