CAZyme Information: H310_00645-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_00645-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511	KI913952|CGC11	56805.74	6.8109

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913952:2065504-2067039(-)

Full Sequence      

MKRSTLRFAACQATTITSRLEQANMDVVTPRDDGGKVIQTPRNDMLYAVAIDDCEDGVTG
ISVEDAQPAAKWSMKRKAVVAAAAALVLVGALVAALMYTHAPNDTTDASFGTGNDISVCY
DSYNDINIATHFRTIRQRFTGIRTYQTRGYRNAIDVAAEAGLKIYAGVWIRTDEASINAD
MQAVVDGVRRNPSVVKGVFVGNEELHVGIDQWTVLGRVRQMRQRLQAAGFGWVPVGSVQV
DGNWGGASALANECDLIGVNIHPFFSAASVSTWNPLEDLKTRWNAMYKAYGNRAVLTETG
WPTSGSQYYGHWPNFDTAKNYYFQVLEWSKGNGGNMPSHFMFHDNTLKPTDFEKSFGLAW
SNGAWKWDAPAAEIKGVVFVNKANDKVLAAAPNRAVEFHARWGNDWVWDWASQWTIRGPL
VVTWDAANKVDLCLDAYQPWNGGAVHLWPCDANNGNQKWAYDGNTKQLRHATHNGFCLDM
ANPAGGTPHLWSCHDPWVSWVTLQQFEWWTR

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.53e-16	104	362	35	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	7.10e-14	431	495	54	119	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	1.25e-10	431	494	11	74	Ricin-type beta-trefoil lectin domain.
238092	RICIN	4.95e-10	427	509	6	83	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
238092	RICIN	1.22e-09	431	494	52	115	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55518.1|CBM13|GH17	2.11e-110	118	501	22	402
AIG56197.1|CBM13|GH17	3.50e-96	116	507	29	548
AIG55595.1|CBM13|GH17	9.70e-95	116	506	18	556
AIG55519.1|CBM13|GH17	1.24e-93	116	506	18	549
AIG56231.1|CBM13|GH17	4.36e-88	116	474	18	367

PDB Hits     

H310_00645-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WUK5|BTGC_ASPFU	1.52e-10	127	318	408	612	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	1.52e-10	127	318	408	612	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|Q0CI96|BTGC_ASPTN	2.57e-10	127	305	375	564	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgC PE=3 SV=2
sp|Q5B430|BTGC_EMENI	3.83e-08	138	305	385	558	Glucan endo-1,3-beta-glucosidase btgC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=btgC PE=2 SV=1
sp|A1CAI0|BTGC_ASPCL	3.97e-08	127	305	415	604	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000001

TMHMM  Annotations     

Start	End
79	101