CAZyme Information: H310_00524-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_00524-t26_1-p1
• CAZy Family: CBM20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1435	KI913952|CGC9	160474.21	6.4169

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913952:1756906-1762861(+)

Full Sequence      

MGLFKGCKSPRKVAQQVHADGPQASSPAAFSNTGQTPGAETSATRKLVGNAAFNDMDLFG
EDSDASDDDAAIERYDRDDESDDDEVHQSRNVEALLSKMTPEEMFVKFDEDHSGMISTDE
FIKMLPQLGIKLSDAKAIRIFDTCDKDGSGEIDLEEFKMAMFTVDPTTGNSLGFSPSSLL
TPKDTFHLFDSNGSGQLDELEFADALEYFGFRVTDAKQERLFQKYDTDKSGFIEYSEFRA
MWLECADVKHELASRGVDVPKYATRKTLMQILAKHLDDEERREEEAMAEAKWFHEWQLEK
IRRKSLADKATLRAQDELAAALDAAGQVYVLGPGQHGQFNSEPAARDALLYDGYTHVSEI
WQARVVPTYVPPDLKLKPPTIHQAPAATPSNYPLVKTRALTPDYIQRRKEKLAEAKAAAT
AAAASAVGENKLPFMRRRSENVTYDINHVSPPKLARQAWRAKPKERASVKTEDATSRETN
EDLSEVLNQKFLEDRAFVRSLRFKDVHPMTNTGWLWGRQVVQAAISDNIAYAVTAPGQIY
CWGGQNKWWKGLEHDEDEDVDVAVKSIDNEAEATRKEVERMRMLTSRSELIKMAAPRFAA
DAVALEVEAQKRKLEEKRLRDLHEDEQYEKHKRVVLYYDKWDPPPSFSTRIIYMQQVLLP
KVDYNRVHKSILARGFHLDRATKQDLIELLGDCLLIESEMCTEEARRGIKQMDFFIQDTE
ELHAKKTKKVEEIPEKAILLDSYQPLKRELERREAEKAATAAQAKEHEAKLKEETYDASI
ERKRVQLEDMCPEYTPRSTSTVMELNGVTARGPPLHPPRGSSAVWKIAAGESFACAVTHN
GSLYSWGVGISGRLGHGKSLEGMMNADSDHPSRVMELKSVFVQDVACAFDHSAALSADGQ
VYTWGSASTGKLGVGLLDDKFEQFAMHPMRVRFPGRKRLRQVSCGRAHTGAVSTDGELFV
WGCANGGRLGLGEQVQDMVAVPTFVASLSRVSVAQVSCGNSHSALCTEIRSDVDGNVETL
SGGDVYVCGSSGPLLQHTPTWSLVAKLRGTPVREVSCGFGHTAAATLAGELFTWGQNVQE
CTGHAAGRRVIDEPELVRAFHVAPYNLAIRKRARQSSVYNEQDAALAVDGNRSGPLHTCI
HTQYDDHPWWEVDLGQPSVLERIKVWNRTDQPVDTSRRRDEFTRRLFPFWIMVSEVPFDD
TMGRASLKAGRDHSNASAQFTEDHRLTEWVLPSTGTVGRYIRIQVKGKRYLHVAQVEVFG
VYNAFNYVGHVSSVQCAKNVTLVVMRPLSSATSIHDHYIKAIQADPDNATILRQYEAYAK
CFQLYGRGEGLTVEKCRLCRATRRCEVCEFYTSTPSNNLPLTTLGEKLGLAEAIDVIMHR
ELPRVAFEKQALTPATIQESITDKFAKVLSLSPKKLTLPLFRLSPSKKDSPVPPS

Enzyme Prediction     

No EC number prediction in H310_00524-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM47	1114	1256	1.1e-23	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227511	ATS1	1.19e-27	784	1098	138	440	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
227511	ATS1	1.16e-22	813	1077	93	367	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
227455	FRQ1	4.13e-19	88	243	2	155	Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms].
238008	EFh	5.05e-17	102	161	3	62	EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.
227511	ATS1	3.04e-16	841	1077	68	311	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKJ27495.1|AA5|CBM47	6.31e-18	1104	1260	724	870
QOX79078.1|CBM47	4.79e-17	1106	1260	131	272
ACD95713.1|CBM47	1.47e-16	1106	1260	131	272
QTD39109.1|CBM47	3.01e-16	1106	1260	1352	1493
QWU89710.1|GT2	1.08e-15	818	1110	973	1267

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4O2W_A	4.76e-25	831	1097	135	381	Crystal structure of the third RCC1-like domain of HERC1 [Homo sapiens],4O2W_B Crystal structure of the third RCC1-like domain of HERC1 [Homo sapiens],4O2W_C Crystal structure of the third RCC1-like domain of HERC1 [Homo sapiens],4O2W_D Crystal structure of the third RCC1-like domain of HERC1 [Homo sapiens]
6XZM_A	5.36e-25	826	1102	116	371	Chain A, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana],6XZM_B Chain B, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana]
6XZN_A	5.36e-25	826	1102	116	371	Chain A, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana],6XZN_B Chain B, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana]
4DNV_A	1.25e-24	826	1102	113	368	Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_B Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_C Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_D Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana]
4DNU_A	1.29e-24	826	1102	115	370	Crystal structure of the W285A mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9VR91|HERC2_DROME	1.70e-28	807	1077	3054	3310	Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster OX=7227 GN=HERC2 PE=1 SV=3
sp|F2Z461|HERC6_MOUSE	8.87e-25	826	1077	26	262	E3 ISG15--protein ligase Herc6 OS=Mus musculus OX=10090 GN=Herc6 PE=2 SV=1
sp|Q8IVU3|HERC6_HUMAN	2.05e-24	826	1077	27	263	Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens OX=9606 GN=HERC6 PE=1 SV=2
sp|Q9FN03|UVR8_ARATH	2.30e-23	826	1102	124	379	Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana OX=3702 GN=UVR8 PE=1 SV=1
sp|Q15751|HERC1_HUMAN	7.04e-23	831	1097	4091	4337	Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000001

TMHMM  Annotations     

There is no transmembrane helices in H310_00524-t26_1-p1.