CAZyme Information: H310_00233-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_00233-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
964		104845.40	6.9426

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913952:811117-814236(+)

Full Sequence      

MDRSPSLQRFLCLMVALSCAVLTSAFQYENVTHPLQGPRKYLHPDVAGKPFPTGAFWTNF
VLGQSNEVVVTYPYAVKIMNHQLHISYPFRVVTSKSIIQGFTSEIAVELGTQPLQIRRFD
DLSVTVAFPQASGGTIILHLVRGSPYMTLEYKDAAPVLLSEANILSVTQPTSAYSVVTLG
NWHQWLVFSSTPFAWTQQGRVWNGPAKFNGVVRIALALQESAKSVLAAHADVYPTGASIT
YNTKPKAKVTDLIFSWTAKTTNALVPTSNLLMVALPHHVQIFAPSTTTLPEIQYMTMRGP
GTGIVGATWHLQEPVIDIPWDYSDQGVFARPNTPEYESTLAFISAALDNDIERFPAFAED
SYNFGKQFGREARLVLTAHRFNKATVFEKGLAKLQNQIRAWLQGTNIDHFVYDTTYGGLI
TNDGYQSNAKDFGNGNYNDHHFHYGYFLYGLAVLRRFNASFVDEHRDAIVYILSDIGAPL
GKTSFVANFPQRDLFPTARHKDWFVGHSYASGLFPQANGKSQESSSEAINAYYALALFTS
LDSDPAYFEYARLLLAMEVRATQLYWHIPAVQTPTIYEPLFAANKMAGVVSEMDVVYSTW
FGDRPAYIHGIQVIPVTPITAVLLPESYVADERQVLDNQPELSNPSDIWSSVLAFDNAIV
DASREWTKLQRTDYNYDTWSSAANAMHWIASRSSFGTHVKPPTKPVALACFGYPACALAG
AFGGSLDCCNTLPGCCPSDKPCCKTDKISEPSTTCHDEPACGILGLSCCGSPQGCCTPSP
VTGLVLGCCKQVTKPPLDGRATNATTQCHAQPKCAAAKLECCNSPQGCCVPTASGQVLGC
CDLTNASLVPTTTLPSTSCHNEPQCGVLGLECCSSPDGCCRTLPSQPKLTCCSQGQPLTS
VWPRKAVVGKAASSCDHNPLCLTAGPDGGVLACWRAAMIRKGVALVTPAAVVRPLGGHWI
VSSW

Enzyme Prediction     

No EC number prediction in H310_00233-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	37	688	1.4e-143	0.9903536977491961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	5.20e-82	50	689	89	748	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	3.98e-78	337	680	4	348	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	2.46e-43	33	321	1	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29064.1|GH81	5.47e-198	17	843	41	944
CCA18874.1|GH81	1.85e-178	23	791	5	846
CAN97272.1|GH81	1.51e-95	27	692	75	717
UQA58532.1|CBM6|GH81	8.35e-95	18	692	271	920
AUX36386.1|GH81	9.68e-95	27	692	70	712

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.19e-37	115	695	130	721	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.48e-37	115	695	155	746	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	6.81e-37	115	695	130	721	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.37e-23	272	696	260	660	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.22e-18	38	615	36	604	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	4.10e-49	50	696	34	703	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	6.23e-42	38	699	213	907	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q12168|ENG2_YEAST	2.36e-41	28	682	91	773	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	3.43e-37	22	690	55	732	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	1.60e-36	50	688	433	1104	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999741	CS pos: 25-26. Pr: 0.9805

TMHMM  Annotations     

There is no transmembrane helices in H310_00233-t26_1-p1.