CAZyme Information: H257_18897-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_18897-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353		37501.07	8.2431

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913370:1820-2881(-)

Full Sequence      

MKPSTIILLGLAAMTTSVEAHGRMLTPPHRGYMYTLPQFSFFPSNYDDDGLSAGGIGSTK
KGLHGICGDRYSAATPRPHETGGKYGLFPKYGAKAIGGCYAPGAIMDIKYQITANHKGYF
EFGLCKLNGKNDAETEACFQTLSQPDGQKQWFLPAGNKIFSLQYQLPSGVTCDGDSHCVL
RSWWVGGNNADVGMDGQEQFWNCADIYISNNCGATPPSPSSGPPTQSPSTTTKPNATNTV
KPAITTIAPQPTYAPSPSTAKPTSSVPQPTYATTTPPSKPTSRPTPSNPKTTQPSYPTQP
PATTSSTDPTKVPSQCGSCANCYYASNNACFIGWSASQCAMQPLFKWCGPSNV

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA15	21	206	9e-54	0.9948186528497409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	7.16e-15	21	206	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
183854	PRK13042	3.44e-07	230	312	22	99	superantigen-like protein SSL4; Reviewed.
237864	PRK14950	1.10e-06	245	315	358	427	DNA polymerase III subunits gamma and tau; Provisional
237864	PRK14950	4.43e-06	236	315	358	439	DNA polymerase III subunits gamma and tau; Provisional
237864	PRK14950	9.61e-06	230	302	359	434	DNA polymerase III subunits gamma and tau; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETV64177.1|AA15	2.24e-238	1	353	1	353
ETV63947.1|AA15	9.12e-238	1	353	1	353
ETV65578.1|AA15	1.47e-117	1	351	1	357
AIG56033.1|AA15|CBM1	4.25e-115	1	218	1	216
ETV71343.1|AA15	2.54e-114	1	349	4	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSZ_A	5.12e-26	21	209	1	193	Lytic Polysaccharide Monooxygenase AA15 from Thermobia domestica in the Cu(I) State [Thermobia domestica]

Swiss-Prot Hits     

H257_18897-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000260	0.999723	CS pos: 20-21. Pr: 0.9811

TMHMM  Annotations     

There is no transmembrane helices in H257_18897-t26_1-p1.