CAZyme Information: H257_18775-t26_3-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_18775-t26_3-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein, variant 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
557		61706.74	6.3451

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913329:8701-10558(-)

Full Sequence      

MSSTKMQAADTAPPDPTLFQYTNALKQFISPTTILPEKATGPVPTNKWWGNLLSLNAAGR
LDPVYPSPYAVFIDNVAATIACSYLYDSMHQGPINVNGAISYYYFPRSSNLIFSCQAPSV
QFSVEDWDDLTVQVSLTSGSSAFLRSVMALGQAYMTIQHGDVPICLSSESGIAAVDGQPF
GDGFLYHGQVDVGKFVVTLHNGQRWLVCWSSPAKGQALTFTCDKQVLKSGAHFNGIVQAA
IVASDDALQILEQYAGGYVHRGVVTCDTVHGFQYHWETRRAAVQSQQPTKASPPVLHFVL
EHHKSILTFHSQAVVPALTLHSHTRGPMTAYLIDSASGNIWDFAFSEQDEQNVERCAQFH
APRDPSVQDIVENRLVDHLQDEINTAATWTLPPGYYFKGKALQKYGSLCLLAAKLASYKE
FQTQVAPLAATALSKLKQLLDTANEFPLCYDVVYKGLITSEVFVKHDVNVEFGNAVYNDH
HYHYGYFITGTQPPRSSIECLYYIYINIYYCASGCIFPILDGLLKESHIVPRYLIDSFPF
VDKNEHGTANQRRAFSD

Enzyme Prediction     

No EC number prediction in H257_18775-t26_3-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	35	489	4.2e-63	0.6093247588424437

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	5.82e-43	3	488	44	518	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	7.72e-30	37	335	9	302	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
407548	Glyco_hydro81C	1.55e-23	395	488	31	120	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26643.1|GH81	4.48e-83	7	491	13	510
CCA20578.1|GH81	8.84e-73	43	491	206	658
CCA20582.1|GH81	8.84e-73	43	491	206	658
CCA20580.1|GH81	8.89e-73	43	491	192	644
CCA20581.1|GH81	8.89e-73	43	491	192	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.03e-18	43	488	41	484	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.08e-18	43	488	66	509	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.38e-16	43	488	41	484	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AIR7|ENG1_CANAL	1.32e-23	42	488	460	901	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.73e-19	37	488	220	663	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	4.52e-19	41	488	432	872	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q12168|ENG2_YEAST	3.42e-18	31	488	99	535	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	8.22e-16	21	488	60	501	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000001

TMHMM  Annotations     

There is no transmembrane helices in H257_18775-t26_3-p1.