CAZyme Information: H257_18396-t26_3-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_18396-t26_3-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein, variant 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387		44002.07	8.0278

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913275:4651-5991(-)

Full Sequence      

MWPSLEEHNLKKSGSALVLCAALLVRWLVSLHSYSGMSTPPMYGDYEAQRHWMELTYHLP
VHDWYFYDLQYWGLDYPPLTAYVSYFFGYIAQFVEPALVALDTSRGYETPSSKVFMRLSV
LVCDIVLFIPSLLLLAKGLYKQQWALRMEFLMLVLLQPAFVLIDHGHFQYNNVSLGFTTL
AVASILQDHEVLGSIFFCCALNFKQMALYFAPAITFYLVAKCLYRPHAILHFVKLGVTVI
ASFAVLWLPLCASTGHATCGPTLAQMLHRVFPIARGLFEDKVANVWCCLDLFLKLRHHIS
PPHLVYLCTGATLVGFLPSVVDLVRRPPSRVRFFLALFNSSMSFFLFSFQVHEKTILLPL
LPVTFLLSEATLLASWFGLVATFRFAP

Enzyme Prediction     

EC	2.4.1.267:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT57	23	382	1.3e-124	0.7733887733887734

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397324	Alg6_Alg8	3.08e-127	22	382	1	372	ALG6, ALG8 glycosyltransferase family. N-linked (asparagine-linked) glycosylation of proteins is mediated by a highly conserved pathway in eukaryotes, in which a lipid (dolichol phosphate)-linked oligosaccharide is assembled at the endoplasmic reticulum membrane prior to the transfer of the oligosaccharide moiety to the target asparagine residues. This oligosaccharide is composed of Glc(3)Man(9)GlcNAc(2). The addition of the three glucose residues is the final series of steps in the synthesis of the oligosaccharide precursor. Alg6 transfers the first glucose residue, and Alg8 transfers the second one. In the human alg6 gene, a C->T transition, which causes Ala333 to be replaced with Val, has been identified as the cause of a congenital disorder of glycosylation, designated as type Ic OMIM:603147.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20779.1|GT57	5.94e-161	5	386	17	426
CCA15270.1|GT57	3.29e-145	8	383	18	408
BDA40477.1|GT57	1.95e-113	13	387	10	385
CAG31431.1|GT57	7.25e-113	11	387	3	379
CAD60191.1|GT57	7.25e-113	11	387	3	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SNH_X	3.01e-99	17	387	59	435	Cryo-EM structure of yeast ALG6 in complex with 6AG9 Fab and Dol25-P-Glc [Saccharomyces cerevisiae],6SNI_X Cryo-EM structure of nanodisc reconstituted yeast ALG6 in complex with 6AG9 Fab [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q802T2|ALG6_CHICK	1.29e-113	11	387	3	379	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Gallus gallus OX=9031 GN=ALG6 PE=2 SV=1
sp|Q54QG6|ALG6_DICDI	2.28e-111	17	387	20	395	Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg6 PE=3 SV=1
sp|Q3T1L5|ALG6_RAT	5.31e-107	18	387	10	379	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Rattus norvegicus OX=10116 GN=Alg6 PE=2 SV=1
sp|Q9Y672|ALG6_HUMAN	2.99e-106	18	387	10	379	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG6 PE=1 SV=2
sp|Q3TAE8|ALG6_MOUSE	2.99e-106	16	387	8	379	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Mus musculus OX=10090 GN=Alg6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000015	0.000001

TMHMM  Annotations     

Start	End
13	35
79	101
114	136
146	163
170	187
207	224
229	251
299	321
333	351
361	383