CAZyme Information: H257_18208-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_18208-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463		49190.21	6.6678

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913256:64996-67203(-)

Full Sequence      

MKSTALLTPMALIMAMMVQDASAHGRLLVPPHRGYIGKLPQFSDFVPVNFGDHSLSAGGI
SQTRGGKHGICGDRYSGKRLHETGGEFAKFPQHREKVIGACYAPGSAMDLQVQLTANHKG
YFEFGLCKLNSLNDKETEDCFKTLVQPNGEKDWQLPAGSKTFNMQYMLPDGLSCDGDSHC
VLRWHYVGWNNPDVGIDGQEQFWNCADIYVSNSCGSSPSPSSSQSTPSTSTPSTSKPAMT
NDPKPTAPSSSADTPVTTDTPVTTDTPVTTDTPDEYKWCGAGDSNPSPSPSNAPNPSTTS
SPNPSTTSSPNHSTTSSPKPSHTCSPKRTPSSNPSTTKQPTLPPSPGTPGVHKKVSWNWF
TSSTTDCDASLSKDTLNRGLYIGGENIPADCGKTASFTYDGRTVKATYAWRTTGGQGYNE
LSPQAFAQLLGSNANAANFNSATDFQAAINDPGHVFSTCSGTC

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA15	24	208	6.9e-52	0.9948186528497409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	2.59e-12	24	208	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETV65004.1|AA15	9.01e-296	1	463	1	463
ETV63929.1|AA15	9.43e-167	1	256	1	256
ETV69628.1|AA15	4.26e-164	7	463	7	516
ETV65134.1|AA15	1.41e-155	1	257	1	257
ETV82190.1|AA15|GH19	4.74e-155	1	292	1	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSZ_A	2.22e-22	24	210	1	192	Lytic Polysaccharide Monooxygenase AA15 from Thermobia domestica in the Cu(I) State [Thermobia domestica]

Swiss-Prot Hits     

H257_18208-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000201	0.999794	CS pos: 23-24. Pr: 0.9761

TMHMM  Annotations     

There is no transmembrane helices in H257_18208-t26_1-p1.