CAZyme Information: H257_18061-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_18061-t26_1-p1
• CAZy Family: GT66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
139	KI913247|CGC1	15498.62	8.0164

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913247:34199-34618(+)

Full Sequence      

MCQQSPKYPCAAGKQYFGRGPIQLSWNYNYKDFGKAVNLDLVASPELVATDFDLVWWSAL
WYWNDERWNGNIHKVVGLPGGFAKATHIINGGLECGVNPPNRDSEKSRIASFKKFCELLG
VAPGDNLSCQTADFRPKAL

Enzyme Prediction     

EC	3.2.1.14:162

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	3	129	2.7e-41	0.6017316017316018

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381595	chitinase_GH19	5.65e-50	2	129	89	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
395130	Glyco_hydro_19	1.21e-38	2	129	93	232	Chitinase class I.
225720	COG3179	4.96e-09	13	93	113	187	Predicted chitinase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETV63620.1|AA15|GH19	3.23e-91	1	138	409	546
ETV82190.1|AA15|GH19	1.72e-86	1	139	473	611
AIG56150.1|GH19	1.32e-78	2	137	81	216
AIG55513.1|CBM1|GH19	5.09e-70	2	136	95	229
ETV65580.1|AA15	3.98e-51	1	105	234	325

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V91_A	4.59e-37	2	129	97	236	Chain A, GH19 Chitinase [Ficus microcarpa],7V91_B Chain B, GH19 Chitinase [Ficus microcarpa],7V91_C Chain C, GH19 Chitinase [Ficus microcarpa],7V91_D Chain D, GH19 Chitinase [Ficus microcarpa]
4TX7_A	9.15e-37	2	129	99	238	Crystal structure of chitinase (GH19) from Vigna unguiculata [Vigna unguiculata subsp. sesquipedalis]
4IJ4_A	9.17e-37	5	129	82	205	Crystal Structure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
3CQL_A	1.74e-36	2	129	97	236	Crystal Structure of GH family 19 chitinase from Carica papaya [Carica papaya],3CQL_B Crystal Structure of GH family 19 chitinase from Carica papaya [Carica papaya]
3WH1_A	3.77e-36	5	129	83	206	Crystal Structure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36361|CHI5_PHAVU	9.86e-37	2	129	169	308	Endochitinase CH5B OS=Phaseolus vulgaris OX=3885 PE=3 SV=1
sp|P06215|CHIT_PHAVU	1.01e-36	2	129	170	309	Endochitinase OS=Phaseolus vulgaris OX=3885 PE=1 SV=1
sp|P42820|CHIP_BETVU	3.30e-36	2	129	168	288	Acidic endochitinase SP2 OS=Beta vulgaris OX=161934 GN=SP2 PE=1 SV=1
sp|P21226|CHI2_PEA	5.10e-36	2	129	162	301	Endochitinase A2 OS=Pisum sativum OX=3888 GN=CHI2 PE=1 SV=2
sp|Q8GUD7|CHIL_HEVBR	2.14e-35	2	129	147	286	Probable inactive chitinase-like protein LaCIC (Fragment) OS=Hevea brasiliensis OX=3981 GN=LACIC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000002

TMHMM  Annotations     

There is no transmembrane helices in H257_18061-t26_1-p1.