CAZyme Information: H257_17732-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_17732-t26_1-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		37429.89	8.0044

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913230:99969-101045(-)

Full Sequence      

MKSSTSVLLTALAISSVVDFADAHGRLISPPHRGYIGKLPKFADLVPVNYDDNGLSAGGI
GGTKGGKHGVCGDPYSGVRQHETGGTYGLFPVHGSKVVGACYAPGSTVDLQVQLTANHQG
YFQFGLCKLNGKHDKETNECFQTLVQPNGDKQWQVPPGNEVFTIQSVLPAGVTCEGDSHC
VLRWHYVGWNNPGVDINGQEQFWNCADVYISNTCGSNPAPSSATPSTSPRTTSAVPTSTK
APSTPPSTTVTAVPTSTKAPSTTPQTTVAAPTSSPKPTQKPTQSPSTTTPTYATLPPKTT
QPSYPTQPPKTIASPTQAPSQCGQCANCYYPLSGACFVGWTAAQCASIPQLKWCGLSA

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA15	24	208	1.6e-52	0.9948186528497409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	5.54e-09	102	208	89	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
223021	PHA03247	4.88e-07	203	324	2802	2938	large tegument protein UL36; Provisional
223021	PHA03247	1.07e-06	215	335	2730	2855	large tegument protein UL36; Provisional
237864	PRK14950	1.57e-06	216	305	362	450	DNA polymerase III subunits gamma and tau; Provisional
223021	PHA03247	5.43e-06	215	326	2753	2857	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETV65578.1|AA15	2.96e-241	1	358	1	358
ETV71343.1|AA15	1.21e-159	1	355	4	309
ETV68872.1|AA15	2.11e-140	5	356	4	306
ETV69628.1|AA15	6.95e-137	11	358	11	311
ETV65579.1|AA15|CBM1	1.82e-135	1	358	1	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSZ_A	2.07e-24	24	210	1	192	Lytic Polysaccharide Monooxygenase AA15 from Thermobia domestica in the Cu(I) State [Thermobia domestica]

Swiss-Prot Hits     

H257_17732-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999753	CS pos: 23-24. Pr: 0.9764

TMHMM  Annotations     

There is no transmembrane helices in H257_17732-t26_1-p1.