CAZyme Information: H257_17489-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_17489-t26_1-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398	KI913221|CGC1	43665.54	6.7827

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913221:91520-92930(+)

Full Sequence      

MLFLVLVATIMLAALPTSSAHVQGAIRSGAVPAHGVNLGSWLVLESWMSKQSPVWVGVPD
AVAVGGEHQTMAFLGHDKADGRFKIHRDTFITAADIAEIAAFGMNVVRVPVGWWIMPDST
NDDWKHYAPGGLAYLDTLIKDWAVRYNVAVMVDIHAAPGSQNGRDHSAAPTLNVANWSRD
DGNIARTLKVAEFLAARYKGDEAFLGLSLLNEPEGNPAANTGVDTAKLHAYYTTAVSRIR
QTGNDCVLVVAPLLTEQSPTASVWPTFLRQKNVWHDWHKYLKWGHEGQPLTQLISQGTEN
IGRDISQWTGNPLFIGEWSLGHPDSAKVEFQDQAQVKLYAVAYLDAVNKAKGGWAFWSWR
ADTGLPLGEGWSMRELLRGGHLKLQQKGECTVSMKSHD

Enzyme Prediction     

No EC number prediction in H257_17489-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	84	362	4.3e-44	0.9638989169675091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.52e-21	34	374	19	373	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	5.04e-20	86	359	20	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55478.1|GH5	1.08e-140	10	384	3	375
AIG56251.1|GH5	1.29e-138	21	391	18	413
AIG55998.1|GH5	5.75e-116	6	389	7	393
AIG56483.1|GH5	1.98e-114	6	384	4	394
AAM18484.1|GH5	5.91e-114	18	384	5	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	3.29e-32	35	380	11	376	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	6.79e-32	35	380	16	381	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PF0_A	6.90e-32	35	380	17	382	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	1.20e-31	35	380	11	376	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	1.31e-31	35	380	17	382	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B5X8|EXGA_EMENI	2.39e-39	30	380	26	388	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|Q96V64|EXG_BLUGR	9.33e-38	35	380	39	401	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|Q0CR35|EXGA_ASPTN	2.90e-37	35	380	42	400	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1
sp|A1DGM6|EXGB_NEOFI	3.01e-37	35	364	44	371	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|B0XRX9|EXGB_ASPFC	3.85e-36	35	364	44	371	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000230	0.999748	CS pos: 20-21. Pr: 0.9729

TMHMM  Annotations     

There is no transmembrane helices in H257_17489-t26_1-p1.