CAZyme Information: H257_17463-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_17463-t26_1-p1
• CAZy Family: GT61
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437	KI913221|CGC2	49007.56	9.1236

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913221:6369-8272(-)

Full Sequence      

MKTLVEIQVYRAVWTACWPIVRWLVRAKDTRRKVPASVSIERTGDAIPPDHFRSSPRGVV
WIHGASVGECLSALPLIKVITDESKDASTMPPCQVLVTTTTPSARALLTQRLVSNPNAHC
IFAPLDHAPCVRRFLDTWQPVAAIWIESELWPNMLVETSSRQISMALLNGRMSTRSFNRW
NSWMGRRLARSLLSHFETVWCQSPQDMHRFQALGLSDTAKYIGDLKFLTTKADMDATSLD
NLKRAVESRVVWTAASTHEGEEALVVEAHVDLLRRHPRLLLVLIPRHPHRVTSIVQAIQS
KHPLVNVTLRSRHGVPEANSDVFIVDTMGETQMCYEVSRVAFVGGSLVPIGGHNVLEPLR
SGCTVLHGPHMANFTSVVQTLGTSPHVVQVTASTLVPTLDRVFLEESSTRSRQLESLEPI
QRTMWTHVYRFLNAIQI

Enzyme Prediction     

No EC number prediction in H257_17463-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	54	228	5e-51	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235589	PRK05749	3.41e-101	10	436	6	407	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
224436	KdtA	1.40e-98	10	396	5	376	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
398219	Glycos_transf_N	5.49e-59	53	227	9	174	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNY92128.1|GT30	2.37e-74	5	437	7	427
QUS41283.1|GT30	7.88e-72	5	436	18	428
BDG75271.1|GT30	1.36e-71	26	392	35	380
CAL79748.1|GT30	2.49e-71	7	381	9	364
QEN87544.1|GT30	2.76e-71	6	374	8	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	1.50e-26	49	370	32	310	Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]
4BFC_A	8.06e-20	246	378	39	170	Chain A, 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8VZA5|KDTA_ARATH	2.38e-56	8	433	9	432	Probable 3-deoxy-D-manno-octulosonic acid transferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=KDTA PE=2 SV=1
sp|Q4UND5|KDTA_RICFE	2.91e-52	29	390	64	413	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=waaA PE=3 SV=1
sp|P0AC75|KDTA_ECOLI	1.80e-51	58	394	49	375	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli (strain K12) OX=83333 GN=waaA PE=1 SV=1
sp|P0AC77|KDTA_ECO57	1.80e-51	58	394	49	375	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 OX=83334 GN=waaA PE=3 SV=1
sp|P0AC76|KDTA_ECOL6	1.80e-51	58	394	49	375	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=waaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000000

TMHMM  Annotations     

There is no transmembrane helices in H257_17463-t26_1-p1.