CAZyme Information: H257_17074-t26_2-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_17074-t26_2-p1
• CAZy Family: GT60
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1404		155541.43	5.2292

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913210:125778-134495(-)

Full Sequence      

MMSLMWMGVATVVAAACSSVAESRQVQVNLTTSFLASPLHPVLETSEYLSQDNPALFFTY
VAAVDVRYNAIKDKNNANYTKVALEAAADVLPADSSVSRLLPFVLQTRAHSPSIELFNQL
AIESAYKACPNQTVSAWAIIYRDAGCADVVLCDIQDFQPSMLHVDEDTSPSSDDSERTCA
ASGQHDFQLPVDHVYPSPNAAAAATAPHVIVYGALISPSFRAFHSTFVPLAVAGNVHYIV
RHAPTDNTLPVLVHGYGVTLHVKNMEYKSFDDSKATSSHNSTATEDDIDADQDEFVVSVL
MKKNDEVAQALREYLDGFEGGQGTDDDDEDAKDVTTPAPWQLTQLGYLATQYIMAAEDPL
KRLQLLSQNFPKYASSLVLASKPVPQQTIDDINHARSQVATQRLYNRIVVNGLPVDFNEY
GFNAFDFLKSLNGELRLADTLAKLDPTGSIKAAMGSLSSAPSDVRISLRGPVDGHAPLYL
NSIETDEETAEWPTDLGSLRGPSWSLIYLRKAMYELILVVDPTTKQGINAMNELIFLRNR
QAPVQFGVLWTSPELLALSAEERATYAPSVEDKDVATVFHVSKMFLAARANGKSARDKYL
REVLSLNDLTVKEVLQIYSQAVGERYTNDDWLQSAKAILTDGDNDGVWAMTNLVAEKNLP
INSQVFNGVVRNHVNVQEDIMTHFARDQPLYQTLVRANQITDDSDMLSELLGNEETYAVF
CPWFDPEYKPPTTVVQLNWNDPVWKQVGSFHASGTVTKPKRQNVLLLANLDTSVGATSAY
HALKRVADFPELRLSVVHTGSPLKDSLGNRIAYILTQLGHTDSTTATAVVLEVLRLMSKK
PEADAISHARLFVQSRVDASSSTSDDEQVLSQLSTWLFSAVAPPFSATLPSLSSLQVIPD
QHVIYVNGRPLELVAPVTPSLFDGLVAYESATRSKAVSKAYVSQFKHNVLTAEDAADKTL
QLNVVLSMVDSYLKTPRVAAVLPDDVQRPTYSYVTPSGSSSLDVVAYLDPLSDTAQRASG
ILRMLHSVLHAKITLVLVPPPSYDEFPLKRFYRFLWGGTSSSLVEFDRLPRHPVLTLNIE
TPELWNVQMVQSDVDIDNIQQNASATFTIKDVLVYGQCVDKTNAQYPTLPNGLQLVLERS
VAKLHSHKDTVVMKNLGYFQLQAAPGVWQLGLAKGRHSTIYELISNDARVDTVPVIVYDF
LSKTLQLEVKKQPGQEGVRLLDDGPEAPKAPAQPEETSVWTSLVQWGAGSSKLETRKGDT
IHVFSLATGHLYERMLKLMMLSVLKRTNNPVTFWLLENFLSPDFKNSVAALQAEFGMDIR
LVTYKWPNWLRRQTDKQRIIWGYKILFLDVLFPLGVDKIIYVDADQVVRADLKELWTMDL
HGKAYGYTPFCDSRNVGFQFWRKG

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1261	1404	2.7e-59	0.5846774193548387

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	2.10e-92	1261	1404	1	146	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	4.49e-81	1261	1404	1	146	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	1.53e-32	1261	1403	1	145	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408199	Thioredoxin_12	1.06e-28	36	244	1	178	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	2.78e-27	1116	1222	2	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55512.1|GT24	0.0	16	1404	16	1383
AIG56125.1|GT24	0.0	7	1404	9	1373
UIZ20865.1|GT24	3.72e-295	8	1404	10	1528
CCA14500.1|GT24	7.59e-250	22	1404	34	1533
ADY40389.1|GT24	7.02e-132	32	1404	39	1381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	2.86e-94	20	1404	5	1325	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	3.84e-94	20	1404	5	1325	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	6.91e-94	20	1404	5	1325	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	2.44e-93	23	1404	1	1318	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	1.77e-76	726	1404	407	1091	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9NYU2|UGGG1_HUMAN	1.39e-127	21	1404	42	1401	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q09332|UGGG_DROME	8.33e-127	22	1404	26	1385	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	3.03e-126	21	1404	42	1401	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q0WL80|UGGG_ARATH	1.93e-124	24	1404	31	1446	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
sp|Q9JLA3|UGGG1_RAT	1.57e-123	21	1404	42	1401	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003714	0.996269	CS pos: 16-17. Pr: 0.5374

TMHMM  Annotations     

There is no transmembrane helices in H257_17074-t26_2-p1.