CAZyme Information: H257_17041-t26_4-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_17041-t26_4-p1
• CAZy Family: GT58
• CAZyme Description: hypothetical protein, variant 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
546		58957.22	6.4198

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913209:215807-218971(+)

Full Sequence      

MTVKEHYDVIVVGGGPAGSVVASQLLAKSPSLSVLLIEAGDATQSALGGTFHSSFTDTSL
PTHWTPFDVPFYWSHVAHLEAFHWNVSNTFIAKALGGCGIHNAMLYVRALPEDILAWNMA
PIWTWDVAQAIYIATEDYDGPKNLPHHGYHGRVRTTRPKLLETASAAFVAGCAQAGLPQS
EDFNAPNGRFGVGYYDFNIRNGVRDSAAMTFLKPLLTTPSPRFRLRLNTLVEKVNIDDKH
RAVSVNIRTSTSISSIIHATEAIVLTAGAIHTPKLLTLSGIASKNVLADLDIPVVVDLPL
VGNNLQDHPAIALLFQAQTPLDINFTTAWEDYIHRAATGWLSTPGLAAGAFLVPPGSTAP
QLQLTFFPRNSEPQWTNASNSQLLFTIALLAPEARNRVVVTSKHMDIPVQVTSEIPQVAS
EHLTPVDAYKLVYGIRVVREIAASLAMQEVVGAEVMPGEGKATDEELLEWVYTSVYRNSH
WVGSAKMGTTADNGVVNQRLQVLNVSRLYVADASVIPIIPNGNVHSTVVMVASHAATLIA
QDLAAP

Enzyme Prediction     

No EC number prediction in H257_17041-t26_4-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	542	7.3e-105	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.85e-85	1	542	2	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	5.12e-74	5	539	4	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.17e-26	392	535	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	6.32e-18	92	310	24	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.31e-16	5	542	54	579	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22502.1|AA3_2	4.91e-151	4	545	80	645
QWC20507.1|AA3_2	1.19e-53	5	546	4	530
QGI77692.1|AA3_2	6.66e-45	4	542	11	533
CCT64188.1|AA3_2	6.66e-45	4	542	11	533
QGI60495.1|AA3_2	6.66e-45	4	542	11	533

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NNE_A	4.57e-46	5	539	12	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	8.67e-46	5	539	12	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	1.19e-45	5	539	12	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
6ZH7_A	2.49e-41	3	539	4	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	4.66e-41	5	539	6	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	6.14e-45	5	539	12	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q8D3K2|BETA_VIBVU	6.52e-43	4	539	2	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q988C9|4PADH_RHILO	7.02e-43	5	542	5	536	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q7MF12|BETA_VIBVY	4.36e-42	4	539	2	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q9WWW2|ALKJ_PSEPU	4.44e-40	7	543	2	531	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000020	0.000018

TMHMM  Annotations     

There is no transmembrane helices in H257_17041-t26_4-p1.