CAZyme Information: H257_17041-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_17041-t26_1-p1
• CAZy Family: GT57
• CAZyme Description: hypothetical protein, variant 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
601		64847.08	6.3847

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913209:215561-218971(+)

Full Sequence      

MTASEISPLLRPHQPSGNSASPQSKPWMKAVLMIMLASVLCVLNVASFRSESVPESIIEE
HYDVIVVGGGPAGSVVASQLLAKSPSLSVLLIEAGDATQSALGGTFHSSFTDTSLPTHWT
PFDVPFYWSHVAHLEAFHWNVSNTFIAKALGGCGIHNAMLYVRALPEDILAWNMAPIWTW
DVAQAIYIATEDYDGPKNLPHHGYHGRVRTTRPKLLETASAAFVAGCAQAGLPQSEDFNA
PNGRFGVGYYDFNIRNGVRDSAAMTFLKPLLTTPSPRFRLRLNTLVEKVNIDDKHRAVSV
NIRTSTSISSIIHATEAIVLTAGAIHTPKLLTLSGIASKNVLADLDIPVVVDLPLVGNNL
QDHPAIALLFQAQTPLDINFTTAWEDYIHRAATGWLSTPGLAAGAFLVPPGSTAPQLQLT
FFPRNSEPQWTNASNSQLLFTIALLAPEARNRVVVTSKHMDIPVQVTSEIPQVASEHLTP
VDAYKLVYGIRVVREIAASLAMQEVVGAEVMPGEGKATDEELLEWVYTSVYRNSHWVGSA
KMGTTADNGVVNQRLQVLNVSRLYVADASVIPIIPNGNVHSTVVMVASHAATLIAQDLAA
P

Enzyme Prediction     

No EC number prediction in H257_17041-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	61	597	1.1e-104	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.16e-84	58	597	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	7.31e-74	59	594	3	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.15e-26	447	590	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	7.25e-18	147	365	24	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.53e-17	42	597	34	579	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22502.1|AA3_2	1.76e-152	30	600	50	645
QWC20507.1|AA3_2	3.47e-53	59	601	3	530
QGI77692.1|AA3_2	4.20e-44	62	597	14	533
CCT64188.1|AA3_2	4.20e-44	62	597	14	533
QGI60495.1|AA3_2	4.20e-44	62	597	14	533

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NNE_A	3.11e-46	55	594	7	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	5.87e-46	55	594	7	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	8.07e-46	55	594	7	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
7AV4_AAA	1.63e-40	9	594	31	636	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6ZH7_A	1.87e-40	58	594	4	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	4.15e-45	55	594	7	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q8D3K2|BETA_VIBVU	2.80e-42	59	594	2	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q988C9|4PADH_RHILO	3.01e-42	60	597	5	536	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q7MF12|BETA_VIBVY	1.83e-41	59	594	2	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|A0A248QE08|FAP_CHLVA	6.19e-40	9	594	31	636	Fatty acid photodecarboxylase, chloroplastic OS=Chlorella variabilis OX=554065 GN=FAP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999957	0.000038

TMHMM  Annotations     

There is no transmembrane helices in H257_17041-t26_1-p1.