CAZyme Information: H257_15897-t26_2-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_15897-t26_2-p1
• CAZy Family: GT41
• CAZyme Description: hypothetical protein, variant 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
725		79045.85	9.1911

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913189:272315-275438(-)

Full Sequence      

MAAPTTAPPRSPPSVARKDTRALSLHASILLGGICILAVAIRLFSVAQWGSVIHEFDPQF
NFRTTKFLATNSFSEFLNWFDDRAWYPLGRVVGGTLYPGLMLISASVYRILHFLGLPVSI
LHICVFFAPFFAAATALATYALTFHVTQRQRTALIAAFFMSIAPAYISRSVGGSYDNEGV
AIFLLVLVFYLWVRSVDSGRMVDAAVTSLAYFGMVLSWGGYVFLINVIPIHVLALVLSGR
YSPRLYVAYSTFYILATLFAMQVPFVGFNVIQKAETLGSHGVFGILQIVAFAKWLESLLG
VHIHRLRAAIVQVGLAGAGVVVVVAVVLQVTGVLQWSGRSLTLLDPTYASKYIPIIASVS
EHQPSAWSGFYMAFGPSLLVVPLGLYFLFEEAPLTSAKLFVLLYSAFAWYFAGVMNRLVL
TLAPATCVVAAVGVSNTLDTLFFYLRRDKPASLSESHGFPGEEAEVAAVARDLERKRAAV
VAQYGNANSIPAHLLEQPDVFGDSIALLIHVVSFNRPMPGRNRKTPGGLQAVVVGVALVL
VWQLLHASSVANRAYSSTSLVHESRNRTTGAEIVHDDFREAFGWLRHNSAPDAVVLSWWD
YGYQLSSYANRTVLVDNNTWNNTHIATVGRVFASTEAAAVPILHSLNVDYVFLLFGGASG
YGVVLIILLSLCSLHCGLVFVLPNVSIIIAGASCTDKATTWTSFRGFSASHKACFRIRWI
WTSSS

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	27	658	2.6e-138	0.7561327561327561

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	4.10e-79	34	446	10	421	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	2.44e-39	21	663	12	613	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA15036.1|GT66	7.02e-207	24	661	59	629
CCA23157.1|GT66	7.02e-207	24	661	59	629
UIZ23018.1|GT66	4.53e-203	9	661	48	630
AFJ69334.1|GT66	6.23e-202	30	661	67	642
CCA17694.1|GT66	2.75e-186	29	660	7	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FTJ_5	3.45e-171	29	661	21	588	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]
6FTG_5	4.56e-171	29	661	21	588	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	9.11e-171	29	661	21	588	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6S7T_A	5.75e-154	42	661	88	667	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6C26_A	9.02e-146	38	662	28	580	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46978|STT3A_MOUSE	4.68e-170	29	661	21	588	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Mus musculus OX=10090 GN=Stt3a PE=1 SV=1
sp|P46977|STT3A_HUMAN	4.68e-170	29	661	21	588	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Homo sapiens OX=9606 GN=STT3A PE=1 SV=2
sp|Q5RCE2|STT3A_PONAB	4.68e-170	29	661	21	588	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Pongo abelii OX=9601 GN=STT3A PE=2 SV=1
sp|F1PJP5|STT3A_CANLF	4.68e-170	29	661	21	588	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Canis lupus familiaris OX=9615 GN=STT3A PE=1 SV=3
sp|Q2KJI2|STT3A_BOVIN	1.86e-169	29	661	21	588	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Bos taurus OX=9913 GN=STT3A PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999997	0.000005

TMHMM  Annotations     

Start	End
22	44
86	108
121	143
153	172
179	196
216	238
245	267
282	304
311	333
367	389
396	413
423	445
526	545
660	682