CAZyme Information: H257_15397-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_15397-t26_1-p1
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		39994.51	4.8208

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913182:258913-260116(-)

Full Sequence      

MMSRRWPFLAVLCTAVYGVDFKLYGVNYNSRQGPDWDPNRCKSQAQVDTDMVAIATVASR
VRIFSLVDCNQGFMVTTAAKKAGLGIWLGMWVSNNQSSLNNELAALDALVTNNVVDNSIE
GIHVGSESLYRKDITPDQAINYFAAVKTYLGSKQLTFPVSITDVLDTLLEYPQVISAVDI
VMANAFPFWEQVDVDAAVNSFKTKFNTLVGAAHGKEVLIGETGWPSAGVNTKASVASPIN
QATYVANFAAFAAAAELKYFMFTAFDDLWKIAQEGVIDTVEAHFGLFDATRNLKPELAYL
TTGGYTPVGGDGNTAVRSGSSPTLFPIADGSATTTQVPQAPAQTSPAVPTNVRQWWRLAL
GIALVLLLLPA

Enzyme Prediction     

No EC number prediction in H257_15397-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	37	294	7.4e-28	0.9517684887459807

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.43e-44	33	291	51	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	5.84e-07	25	294	2	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56146.1|GH17	6.73e-107	1	300	1	298
AIG55438.1|GH17	6.47e-103	9	301	12	310
AAM18482.1|GH17	1.87e-67	21	298	26	310
CAJ90910.1|GH17	5.92e-66	4	294	6	306
AIG56195.1|GH17	9.74e-65	25	349	22	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.63e-42	24	295	38	290	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.23e-41	24	295	38	290	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DEV5|BTGC_NEOFI	1.39e-26	18	306	386	686	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	4.59e-26	18	306	386	686	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|Q4WUK5|BTGC_ASPFU	4.59e-26	18	306	386	686	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|A2QN74|BTGC_ASPNC	1.51e-25	18	306	382	682	Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=btgC PE=3 SV=2
sp|Q5B430|BTGC_EMENI	2.12e-24	18	306	347	647	Glucan endo-1,3-beta-glucosidase btgC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=btgC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000499	0.999470	CS pos: 18-19. Pr: 0.9705

TMHMM  Annotations     

There is no transmembrane helices in H257_15397-t26_1-p1.