CAZyme Information: H257_15274-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_15274-t26_1-p1
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
812		90778.25	6.3904

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913181:219962-225227(+)

Full Sequence      

MHVALAAAVLLTGYTCAHAVDETSDVDDALRWGTYHSGHYFGIRSRTSPFHVSAGLLWST
SKEPKLRHECLESDHLEQYGWLEHDGRTFGSQTIRDQHNNLLLDTTFLKPPTSPTTFATR
SWAARVAVTPLRADVALPDTASLFFYLDLGCEDDSLTHACRRDTQQGASWSVQPPTTCRQ
PPPNGQSCIELEIVSAHANPIFAFHARFQVHFRGAPQDLSVQYQGESSWSVVNIRKTLLD
LTNSYPDNAPTITRLTNILAPSSTLALVQLTFSPSIVNDLTLHLLYDEAADEVLSTTPVV
VMDGMLPSFHLAFQAKFHAAFPHISPEFEPLGQAALSNLIGGIGYFYGSTILQQADGQAT
QTNPARSLLSAVPSRSFFPRGFLWDEGFHLLGIIPFDTQVAVQVVDAWLDLMDDDGYISR
EQIRGSLAEARVPAEFITQFPTHANPPSLLLAVEKLLPHLSQSAVLHRWWPQLRKWFAWF
QRTQAGEEPHTFRWRGRDVHDGKLMPNTLSSGLDDYPRASHPSADERHVDLAAWMIKGSA
ILAKVALAVGDTVEARTFSELSQAYLDTMNHLHWDPATSLYYDYGLHSDDGLFEDHLVIR
CQNPSTGDSIQTTANVQVLRKNRNDGCPRTHPHFQYPLGDGNGGLLGKQVFVPKTERLQF
VRRVGYVSFFPLFLQILPLNSPKLAPLGTLVANELLSLHGLMSLSPQDLYFERPNAPGDA
PYWRGPIWMNINYLALGSFQHYATHASDKSVREQYQSLYDTLRDRVVAAISHEYKATGYL
YEQYNPHTGRGQRCHPFSGWTALVVNILAETY

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	381	810	3e-26	0.35964912280701755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	1.35e-175	306	810	10	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	1.09e-31	30	146	1	116	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
236653	PRK10137	9.23e-05	523	583	572	632	alpha-glucosidase; Provisional
215307	PLN02567	8.59e-04	529	591	328	390	alpha,alpha-trehalase
225942	GDB1	0.010	668	805	486	599	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56123.1|GH63	3.16e-290	1	812	1	797
AIG55648.1|GH63	8.15e-278	28	812	16	797
UIZ28949.1|GH63	3.29e-204	18	812	53	896
CCA18876.1|GH63	1.10e-162	27	812	65	967
CAD7224701.1|GH63	5.51e-133	20	812	67	803

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MHF_A	1.29e-127	30	812	37	779	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
4J5T_A	6.62e-75	27	810	12	802	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O88941|MOGS_RAT	4.10e-129	32	812	94	834	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	8.07e-129	30	812	92	834	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	5.46e-120	30	812	94	837	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
sp|Q84M89|GCS2_ARATH	1.33e-118	28	812	44	786	Alpha-glucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=GCS2 PE=2 SV=1
sp|F4HTM3|GCS1_ARATH	3.10e-111	28	812	107	849	Mannosyl-oligosaccharide glucosidase GCS1 OS=Arabidopsis thaliana OX=3702 GN=GCS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000250	0.999749	CS pos: 19-20. Pr: 0.9099

TMHMM  Annotations     

There is no transmembrane helices in H257_15274-t26_1-p1.