CAZyme Information: H257_15224-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_15224-t26_1-p1
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		32318.17	7.5202

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913181:27166-28086(-)

Full Sequence      

MKITRIAATATPTSAVAHLADAHGRLVSPPHRGYIGKLPQYKGLVPINYSDNGLSAGGIG
QTSGGKNGICGDPYTGVREHETGGVYGRFPQHREKVVGACYAPGSTIDVQVQLTANHKGY
FEFGLCKLNHLNDKETEECFQALAEPSGLKEWQVPPGNGFFDIQYVLPSGVTCDGDSHCV
LRWHYTGWNNAGVGALGQEHFWNCADVYISNTCGASNPTPSSAKPSTSAVATQPPRPTQP
QAPSTSKPTIPTQPPQTSAPSNPTPAPVPGQCGTCANCYYAPTNACFAGWSAAQCAQVPV
FKWCGV

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA15	23	207	6.9e-52	0.9948186528497409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	1.59e-12	23	207	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
235540	PRK05641	8.94e-05	220	271	44	94	putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated
411474	fibronec_FbpA	1.86e-04	215	267	183	240	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
273167	rad23	4.81e-04	210	270	81	143	UV excision repair protein Rad23. All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
237865	PRK14951	6.29e-04	214	299	369	451	DNA polymerase III subunits gamma and tau; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETV68872.1|AA15	1.73e-216	1	306	1	306
ETV71343.1|AA15	1.69e-169	4	305	8	309
ETV65578.1|AA15	7.30e-140	4	306	5	356
ETV63620.1|AA15|GH19	3.50e-138	43	305	12	275
ETV69628.1|AA15	4.04e-129	4	305	5	308

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSZ_A	2.76e-28	23	209	1	192	Lytic Polysaccharide Monooxygenase AA15 from Thermobia domestica in the Cu(I) State [Thermobia domestica]

Swiss-Prot Hits     

H257_15224-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000036

TMHMM  Annotations     

There is no transmembrane helices in H257_15224-t26_1-p1.