CAZyme Information: H257_14650-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_14650-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516		53934.83	6.4117

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913173:53643-55193(-)

Full Sequence      

MTIATFLSAYALGLAAISNYAHAHGRLIAPPHRGYIGKLAQFAGIVPPDYGDHGLNAGGI
AATSGGKFGVCGDSYTGVRQHETGGTYGTFPTNGAKAIGACYAPGSTVDLQVQLTANHKG
YFEFGLCKLDMKHDKETNECFQTLAQPNGETQWQVPPGNEVFTIQSVLPAGVTCEGDAHC
VLRWHYVGWNNADVGIDGQEQFWNCADVYISKTCGTVPAPSPSKPSSGPAPSFSTNPTYD
LAPSSSKPTAAPMPSSSTSIPPISTHSQSTSQGSCGTCNNCYYPDTNACFIGWSAAQCAR
VAEYNWCGPAASSAPVCGTCTNCYYPGSNACFIGWSAAQCAQNPAFNWCGANAVLPSTTT
PITTSPGTKPDTHPPSYKPTTTQVPSAKPIMYATSPPSPSSPGVSNKVSWNWFASSTTDC
DASLSKDTLNRGLYIGGENIPADCGKTATFTYNGHSVTATYAWRTTGGQSYQELSPQAFA
KLLGSDVDVSTIGSAQQMQQAINDPGHVIAQCNGAC

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA15	24	208	9.8e-52	0.9948186528497409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	3.57e-10	102	208	89	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETV69628.1|AA15	0.0	1	516	1	516
ETV75332.1|AA15	1.29e-176	1	397	1	398
ETV75325.1|AA15	2.09e-163	1	311	1	286
ETV65004.1|AA15	3.11e-162	7	516	7	463
ETV65578.1|AA15	8.76e-138	11	311	11	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSZ_A	8.66e-23	24	211	1	193	Lytic Polysaccharide Monooxygenase AA15 from Thermobia domestica in the Cu(I) State [Thermobia domestica]

Swiss-Prot Hits     

H257_14650-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000255	0.999689	CS pos: 23-24. Pr: 0.9745

TMHMM  Annotations     

There is no transmembrane helices in H257_14650-t26_1-p1.