CAZyme Information: H257_14644-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_14644-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
196		21239.22	9.3164

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913173:17147-17807(+)

Full Sequence      

MKPTAFFTPMTLIMTMMVQDASAHGRLLVPPHRGYIGKLPQFSGLVPINFSDHGLSGGGI
GQTKGGKHGICGDSYSGKRLHETGGEFAKFPQHREKVIGACYAPGSTMDLQVQITANHKG
YFEFGLCKLNSRNDMETEDCFKTLVQPNGEKDCQLPAGAKTFNMQGWSALLTGWRRRSSH
SGCQGSRGGDARACAR

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA15	24	164	1.4e-32	0.7357512953367875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	3.09e-05	102	182	89	177	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETV69622.1|AA15	3.80e-147	1	196	1	196
ETV63929.1|AA15	1.31e-102	1	165	1	165
ETV65004.1|AA15	1.30e-101	1	165	1	165
ETV65134.1|AA15	5.78e-99	1	165	1	165
ETV63735.1|AA15	1.20e-98	14	165	1	152

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSZ_A	3.92e-16	24	141	1	114	Lytic Polysaccharide Monooxygenase AA15 from Thermobia domestica in the Cu(I) State [Thermobia domestica]

Swiss-Prot Hits     

H257_14644-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000259	0.999727	CS pos: 23-24. Pr: 0.9750

TMHMM  Annotations     

There is no transmembrane helices in H257_14644-t26_1-p1.