CAZyme Information: H257_13245-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_13245-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310		32653.51	7.3000

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913160:1317-2249(+)

Full Sequence      

DINMKPTTSILLSALALSSVVDFADAHGRMLSPPHRGHIGRLPKFSGLVPINYSDNGLSA
GGIGGTKGGKHGVCGDAYSGVREHETGGTYGRFPIHGSKVVGACYAPGSTVDLEIQLTAN
HKGYFQFGLCKLSGKDDKETEECFKALAQPSGETQWQVPPGNQVFNMKYVLPSGVTCDGD
SHCVLRWHYVGWNNYGVDINGQEQFWNCADVYISNTCGASNPTPSSAKPSTSAVATQPPR
PTQPQAPSTSKPTIPTQPPQTSAPSNPTPAPVPGQCGTCANCYYAPTNSCYAGWSATQCA
EVPGLKWCGA

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA15	27	211	3.8e-53	0.9948186528497409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	1.14e-09	105	211	89	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
235540	PRK05641	6.71e-05	224	275	44	94	putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated
411474	fibronec_FbpA	3.46e-04	219	271	183	240	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
273167	rad23	3.94e-04	214	274	81	143	UV excision repair protein Rad23. All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
411345	gliding_GltJ	6.73e-04	218	274	424	479	adventurous gliding motility protein GltJ. Adventurous gliding motility protein GltJ, also known as AgmX, occurs in delta-proteobacteria such as Myxococcus xanthus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETV71343.1|AA15	3.00e-219	1	310	1	310
ETV68872.1|AA15	8.50e-170	8	309	4	305
ETV65578.1|AA15	1.48e-159	4	309	1	355
ETV69628.1|AA15	4.46e-132	4	309	1	308
ETV63929.1|AA15	1.12e-126	4	299	1	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSZ_A	2.47e-24	27	214	1	193	Lytic Polysaccharide Monooxygenase AA15 from Thermobia domestica in the Cu(I) State [Thermobia domestica]

Swiss-Prot Hits     

H257_13245-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999744	CS pos: 26-27. Pr: 0.9730

TMHMM  Annotations     

There is no transmembrane helices in H257_13245-t26_1-p1.