CAZyme Information: H257_12919-t26_4-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_12919-t26_4-p1
• CAZy Family: GT2|GT2
• CAZyme Description: trehalose-phosphatase, variant 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
810		91106.13	7.7628

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913157:7686-11830(+)

Full Sequence      

MSMVHHPSQLPVLVASNHLPVLLERREDGKYAATWRGDRLLASTMAFSHRDLFRPSRRKV
RFLGRVELEVSLQDQPAVNEACAAISCIPVFPSAETDVATYDAFCSGPLRAVFHNMVHPS
TLNPPSHVQENADPWPAFLAMNKDFAVAISKAYATGDILWLQDFDLVMVPHFLARLVRPM
TVPSTVGLFIHVPFPSKSVLSTLSHDRDILRSMLTVHHVGFHIYEHARHFLDACEALIRT
PPPSMIQGQLVVHHNGKQVHITCAQLTVDAARVERDLASNDSVRDEIIRWRQLHKLIFAA
VDVVDELHGIPHKVVAFHQFLKKRPEYASRVLLVQVGVVTSTLGSTQHAQEVRRLVDDIN
AQYPTPVIVFDVRNDRMPTVDRIALWRVAEVFVSTVFAEGLNTCPFEYLVTHRNATGLAI
LSQFAVARRILHGATIVNPWNIHSIATAMEATVHMSLKEKEFRRDCDVLSIASHTPTRWA
ATILSDIAAAASAPPKKLDVLTKPLTVEHLLDLYYKSRGRRIFFFDYYRTLAPDVSSDFG
IVWPDVPVDVLSSLEQLCRDPRNTVFVVSGCNCELLSDKFGSVPGLGLVAEHGYFIRWAM
LGRAARINKPWELYGDVFRVNASCGKWREKAEAIMLMYVDRTNGAALEMRRSSILFRYAS
ADYGFGLLQARELLHQLTAAFDGWPLSVIQGKDYIEVRPEGLGKGKIVKQILHKLHMDSI
KSDEHPASSSHHGAIDFVWTMGDDVADELMFDAAHDCGHAFNIAHGTIHTVRLIYIAVLP
KIWAFFCTKYAKNRSIDRIFITECCISKVW

Enzyme Prediction     

No EC number prediction in H257_12919-t26_4-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	12	488	6.1e-95	0.9663157894736842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	6.61e-106	12	770	3	704	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
177855	PLN02205	1.62e-99	12	753	62	799	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
340820	GT20_TPS	2.56e-88	11	487	1	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
215555	PLN03063	4.45e-78	12	742	13	707	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
395781	Glyco_transf_20	1.56e-77	12	487	3	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27356.1|GT20	1.01e-208	9	752	21	784
CCA16404.1|GT20	4.16e-161	14	756	8	785
CCA19238.1|GT20	1.69e-111	12	751	265	1035
UIZ24099.1|GT20	3.14e-111	12	756	292	1082
CCA18368.1|GT20	1.19e-102	12	756	324	1095

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HUT_A	8.20e-54	12	487	6	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	1.54e-53	12	487	6	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HVM_A	2.13e-49	12	487	14	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVO_A	5.33e-47	12	487	13	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	8.96e-46	12	487	2	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q94AH8|TPS6_ARATH	4.80e-88	12	752	55	804	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 OS=Arabidopsis thaliana OX=3702 GN=TPS6 PE=1 SV=2
sp|Q9LMI0|TPS7_ARATH	2.00e-85	12	753	61	788	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7 OS=Arabidopsis thaliana OX=3702 GN=TPS7 PE=1 SV=1
sp|O23617|TPS5_ARATH	6.46e-85	12	752	62	793	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana OX=3702 GN=TPS5 PE=1 SV=2
sp|Q9LRA7|TPS9_ARATH	9.76e-85	13	753	62	794	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|Q0WUI9|TPS8_ARATH	1.11e-84	13	753	60	789	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000000

TMHMM  Annotations     

There is no transmembrane helices in H257_12919-t26_4-p1.