CAZyme Information: H257_12486-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_12486-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
590		63026.74	4.6710

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913154:92328-94208(+)

Full Sequence      

MRLVATAAAAILVTFLGTSVDAIAPIEIKGNRLFEYGTGKPFHAKGLDYYPRPNSGELNV
NNLDFFTDDHEHIWKPHVAEFIALGINAVRLYAVDSSKSHDKFMCALSEAGIYVLVDLAA
SCEDCAITKDPYPACYPAPLKTRGQQIIAAFSKYNNVLAFSAGNEVNHYVDSMEISAPCQ
KKFIKDMRAYISSCATNMRYIPVGVVLADHQRSKNALYYACRTDPTDELENAEWYGLNAY
LQCDRTASPWHVGPGYDKLLKDFTSYELAIPTILTEFGCLNVGFPTVDGFQAQRTWVDAA
WLLSPTFADVFAGGFAFEFTTEKANAEKDSPFPFKTFGPQNYGLGYLEPETCDADKTPCV
FQRMPNFDSLAAAYRDASTAGLPERSSYSPSHTKPPQCPAGVRPIGEVHWSADSETDVQC
PDLTQTPLCPGDIINTGKAGPPKPSVTTEDPVKDVPTETPTSTPLPTTNSSTPLPTTTSS
TPLPTTNSSTPLPTTTSSTPLPTTTPAEPSPPSNVTDTVTPSTASPPSNGTGTVTPSTAS
PPSNGTGTVTPSTASLPSPGSTQGNPATVAAPGVVGVVVMATVAWLMVWV

Enzyme Prediction     

No EC number prediction in H257_12486-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	21	325	2e-76	0.9006410256410257

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	8.04e-56	19	378	5	315	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
398978	Epiglycanin_TR	8.72e-04	508	563	10	65	Tandem-repeating region of mucin, epiglycanin-like. The unusual mucin, epiglycanin, is membrane-bound at the C-terminus but has a long region of this tandem-repeat at the N-terminus. It was the first mucin identified to be associated with the malignant behaviour of carcinoma cells. Mouse Muc21/epiglycanin is thought to be a highly glycosylated molecule, which makes it likely that its function is dependent on its glycoforms. Cells expressing Muc21 are significantly less adherent to each other and to extracellular matrix components than control cells, and this loss of adhesion is mediated by the TR portion of Muc21. This family also now contains the repeat that was the C. elegans protein of unknown function (DUF801).
398978	Epiglycanin_TR	0.005	508	568	3	58	Tandem-repeating region of mucin, epiglycanin-like. The unusual mucin, epiglycanin, is membrane-bound at the C-terminus but has a long region of this tandem-repeat at the N-terminus. It was the first mucin identified to be associated with the malignant behaviour of carcinoma cells. Mouse Muc21/epiglycanin is thought to be a highly glycosylated molecule, which makes it likely that its function is dependent on its glycoforms. Cells expressing Muc21 are significantly less adherent to each other and to extracellular matrix components than control cells, and this loss of adhesion is mediated by the TR portion of Muc21. This family also now contains the repeat that was the C. elegans protein of unknown function (DUF801).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55987.1|GH72	2.46e-211	19	439	34	451
AIG55902.1|GH72	1.33e-209	11	437	3	445
AIG55654.1|GH72|GT31	4.32e-194	19	447	16	447
UIZ27746.1|GH72	8.94e-169	25	448	24	451
AIG55850.1|GH72	8.69e-165	11	433	4	429

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	2.68e-29	17	399	27	368	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	6.51e-29	17	399	27	368	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	6.51e-29	17	399	27	368	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9Y7Y7|GAS4_SCHPO	4.71e-34	25	403	27	371	1,3-beta-glucanosyltransferase gas4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas4 PE=1 SV=1
sp|Q5AJY5|PGA4_CANAL	8.11e-34	12	325	6	294	1,3-beta-glucanosyltransferase PGA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PGA4 PE=1 SV=1
sp|O13692|GAS5_SCHPO	6.09e-33	21	391	24	347	1,3-beta-glucanosyltransferase gas5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas5 PE=1 SV=1
sp|P0C7S9|GEL1_ASPFU	3.33e-32	21	440	27	383	1,3-beta-glucanosyltransferase gel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel1 PE=3 SV=1
sp|B0XT72|GEL1_ASPFC	4.53e-32	21	440	27	383	1,3-beta-glucanosyltransferase gel1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000226	0.999735	CS pos: 22-23. Pr: 0.9796

TMHMM  Annotations     

Start	End
567	589