CAZyme Information: H257_12369-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_12369-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
428		46770.98	6.4716

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913153:241698-243714(-)

Full Sequence      

MLPSSESKPLFNGRAAPHPLAAYRQLGLTLAGCFAIFALVFLCTDSPVGMQPDDEDASTA
ALPTVSSWSTPTQRPSTCPEILPQDRVVLFWQSEVGGCEQVPNGVTHVVFGFAQTFGGIV
TPSFQGAVASCVQSLRQRCMYVMGVIGGANNNVGMSTIHDPQAFAASVKSFVQQYLLDGV
DIDDETSYFEGLYDDHRVRSYMQALHTALKTNGNDYLLSYDAYMLEADPVCWKSARCFAK
GVEEYVDWVNVMAYNVDTNVARANQIYAGATKNVFEAWARIVPRDKITMGMCMGGACSYG
PGPPSWVVQSWAQYNYASHMGGLMIYAGSMDINTGFETTKQIVLWMRQAAKTFGGRRWRT
PRLTTTATTSSTSTTATTRTPAPTPSPHRRDSTVCGMCANCLYVPTHGCYIGWTYDQCTA
SAFTWCGQ

Enzyme Prediction     

EC	3.2.1.14:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	101	293	8.4e-25	0.581081081081081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395573	Glyco_hydro_18	7.68e-20	102	355	20	298	Glycosyl hydrolases family 18.
119349	GH18_chitinase-like	1.62e-17	102	256	21	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
214753	Glyco_18	4.47e-15	102	295	23	237	Glyco_18 domain.
119365	GH18_chitinase	2.67e-10	162	291	111	259	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119350	GH18_chitinase_D-like	4.39e-08	146	308	80	242	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55900.1|GH18	4.79e-15	78	312	77	336
UII31517.1|CBM6|GH18	9.02e-09	86	291	32	240
AGY54522.1|GH18	7.26e-08	162	305	139	292
QEC44030.1|GH18	1.26e-07	102	291	58	273
UOB18382.1|CBM6|GH18	6.07e-07	86	291	28	236

PDB Hits     

H257_12369-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

H257_12369-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000020	0.000013

TMHMM  Annotations     

Start	End
20	42