CAZyme Information: H257_12148-t26_2-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_12148-t26_2-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431		47591.84	9.0072

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913152:77723-79429(-)

Full Sequence      

MSSLAQVVAAAVLSRAWVSAMALVSHTFITPYDTSALAHSKSIFSAFAAWDGVYFVDIAG
EGYRYENTHAFFPLFPLLVRWTSPLLLPVLDKNTSLLAAGWLISNVCFVLAAVYLYRLGL
LLLNNESLAKRAAYFFCICPSGIFMSACYSESLMCVLSFSGMYCLERYRTAARSTSGHIY
LSLSALLFGLSAATRSNGILHSLYIAYYRLLTSPHPLRAFPRFFGYWTYTALLGVVAIGF
QVAYFVVGVAAYCPSFAAVIQPLRSVMDMPMTSALTQDRPWCSQVLPNYSAMYLFIQREY
WGVGPFAYYQLKQIPNFVLAGPMIALAAYAVYVGCISPKILSFSAARPYFVHVAFLLANA
LVVVHIQVITRFLAASPPIFWAAAFVTTPDPKQPANSQVQSAVVVTHGLVLYFLVFNVVG
ATLFPSFYPWT

Enzyme Prediction     

No EC number prediction in H257_12148-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	8	431	1.3e-94	0.995085995085995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	3.50e-45	11	431	8	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	5.36e-06	11	381	37	361	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28864.1|GT76	1.35e-119	7	431	9	439
CCA18790.1|GT76	4.04e-100	11	431	13	490
BBN03197.1|GT76	1.92e-53	50	431	84	482
BAF29832.1|GT76	2.16e-52	2	431	3	486
BAT17237.1|GT76	2.16e-52	2	431	3	486

PDB Hits     

H257_12148-t26_2-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5KR61|PIGV_RAT	3.19e-41	41	431	57	492	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q7TPN3|PIGV_MOUSE	4.34e-40	41	431	57	493	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q9NUD9|PIGV_HUMAN	5.76e-39	41	431	57	493	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
sp|Q290J8|PIGV_DROPS	1.77e-34	50	431	66	452	GPI mannosyltransferase 2 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA19757 PE=3 SV=1
sp|Q9V7W1|PIGV_DROME	2.57e-31	50	431	62	449	GPI mannosyltransferase 2 OS=Drosophila melanogaster OX=7227 GN=PIG-V PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999769	0.000256

TMHMM  Annotations     

Start	End
314	336
349	371
408	430
7	29
97	119
132	154
177	199
223	245