CAZyme Information: H257_12018-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_12018-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
594	KI913150|CGC1	68450.25	7.3664

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913150:543517-546100(-)

Full Sequence      

MGRPSRPWPLDGNGSVNSPVMRWAWNACVGCFRGTRNAASMLWRRLERRPRVLRFLLALL
VMIGVGVAIWLLTPEVPVPKYSDKDTTMHTIPNFQEDHIPALWTDDAYECVGWQETDSCE
PEDITSRRPLETKKCDETIDQRRAGFCQVRNKTSGAILRLMVSSCHSMQHRQYTCDMARN
FSEFALLAATYQHMPLATSLSLPEAQQHPPTRAILMIVYDKVLPSAYAAIRVIRDHGCTL
PVEMWYRPDEMQIDDNALIQHLVADFNVHLRQIFDPRAVGFHTKPYAVYYSHFDSILLLD
ADNVPVRDPTYLFDDPAFVETGALFWPDYWQPPNSLFDVTSHSLLWQLLQMEFLSEFEQE
SGQVLINRRRAPAALNKLMYYSTHGPKLLDNLKLIWGDKDLFRLAWRNTSTAYHMMAKPP
AIGGIYSYTKRIFCGLAMIQYDPQGEILFFHRNSIKLDGSPNQPHVITHIQQYRGDSRDY
RVGQIISELDQESCYYIRTNRSLASGATPTYVTPIEFTPFDAVEPAAIAYSVEGRRIVEA
AASGLATSWWWPWRWIERMGYASVCMAGVFYGLRWWRAHEAKAHLTTNNRWKSY

Enzyme Prediction     

No EC number prediction in H257_12018-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	214	442	4.1e-49	0.9848484848484849

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	4.57e-36	212	442	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	0.002	220	329	10	127	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28362.1|GT71	1.09e-167	84	538	646	1105
CCA20955.1|GT71	8.88e-159	77	539	75	553
UIZ27901.1|GT71	4.61e-122	97	539	59	510
AIG56191.1|GT71	9.57e-111	100	531	35	483
CCA25306.1|GT71	6.84e-107	46	538	8	536

PDB Hits     

H257_12018-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A687|MNN22_CANAL	2.98e-18	202	454	153	448	Alpha-1,2-mannosyltransferase MNN22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN22 PE=2 SV=1
sp|A6ZQE9|MNN5_YEAS7	2.40e-14	211	442	149	433	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|Q59KJ7|MNN21_CANAL	3.58e-14	229	447	263	531	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|P46982|MNN5_YEAST	5.55e-14	211	442	149	433	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|Q5AD72|MNN24_CANAL	2.02e-13	229	443	310	559	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999876	0.000133

TMHMM  Annotations     

Start	End
52	74