CAZyme Information: H257_12008-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_12008-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574		63009.18	7.5832

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913150:505005-507234(-)

Full Sequence      

MHRRLHRAASKRADYIIVGGGSAGCVLANRLSKSNSVLLVEAGPSDRGKWDSWKMKMPAA
LTFNLADDKYNWAYKTVPQVHLDNRRLDWPRGRVLGGSSSLNAMVYIRGHAQDYDDWEAA
GAKGWSYADVLPYFKRAQSHALGGDTYRGGDGPLHVSRGSQRDQVLFQAFIDAGVQAGYP
FTDDMNGFQQEGFGFMDSTIHNGVRWSSSAAYLHPVLHERKDRLSVVTDHLVHRVVVDDA
GTAQGIDVQPNRHSKSHDVEFYQADKEVIVCGGAINSPQLLLLSGIGPADALKAVDVPVV
QDLPAVGQNLEDHLDLYVQFGVTKPITLHNATWIYPHKMAAIGLEWMVRQTGMGASAHLE
SGGFIRSRPGLRHPDLQFHFLPGALTGQLTPGSQHAMQTHISPLRATSRGSLALTTCNPR
DPPRLDPNYLSTTQDVDDIRQGVLLAQELFQQKAMDPFRGHPISPATLFAAHEASAIDAW
VRQHTESAYHPSCTNRMGHDTRSSVVNSKCQVHGVDRLRVVDASIMPNIISGNLNAPVIM
MAEKAADIILDNAPLPSAKHVPVYVAPKWESSQR

Enzyme Prediction     

No EC number prediction in H257_12008-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	551	6.3e-157	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	0.0	9	574	2	555	choline dehydrogenase; Validated
225186	BetA	7.75e-173	6	558	1	542	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	2.86e-82	13	550	1	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	1.72e-51	83	315	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.61e-39	407	545	2	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28087.1|AA3_2	4.50e-265	2	574	15	581
CAB3230510.1|AA3_2	1.13e-203	8	573	20	578
AWP09430.1|AA3_2	6.23e-202	7	549	14	550
ANI26486.1|AA3_2	1.01e-200	14	573	72	624
CAG5089487.1|AA3_2	2.03e-176	3	555	7	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YRU_AAA	1.08e-76	9	566	4	577	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	1.51e-76	9	566	4	577	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	1.57e-76	9	566	20	593	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS2_AAA	2.12e-76	9	566	4	577	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	2.96e-76	10	566	5	577	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8BJ64|CHDH_MOUSE	1.72e-202	15	574	45	596	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q6UPE0|CHDH_RAT	1.77e-200	15	574	48	599	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	5.57e-198	3	574	28	594	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q6LGH5|BETA_PHOPR	1.27e-174	14	574	6	554	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	1.27e-164	14	574	6	554	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000008

TMHMM  Annotations     

There is no transmembrane helices in H257_12008-t26_1-p1.