CAZyme Information: H257_11800-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_11800-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	KI913149|CGC1	33405.68	7.0982

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913149:81636-82598(+)

Full Sequence      

MKFASAVATLSSLALWSHSVEGHGRLVSPPHRGYIGKLPAFQGLVPVNYDDDGLSAGGIG
GTQGGKHGVCGDPYTGVREHETGGKYGLFPVHGNRVIGKCYAPGAAIDLTVEITANHWGH
FEFQLCKLGTKDAKETEECFQNLVQANGQKDWEVPRVGKATFNMQYKLPAAVTCEGDAHC
VLRWWYISGNNPGGLNAQEQFWNCADIYISNTCGAPAPPTALPITSTAAPVTTAKPTITT
TTAPQPTTAAPKPPTAAPATTPAAPVTTPTGPITAGPTPAPPVGACGSCTNCYYAPTNAC
FSGWTKEVCASVSSFQWCGP

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA15	23	207	8.4e-55	0.9948186528497409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	5.43e-11	23	207	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETV73258.1|AA15	7.14e-207	1	320	1	320
ETV73257.1|AA15	2.28e-134	1	319	1	323
ETV71343.1|AA15	1.51e-119	10	319	12	309
ETV68872.1|AA15	4.35e-118	1	319	1	305
ETV65578.1|AA15	1.90e-114	1	319	1	355

PDB Hits     

H257_11800-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

H257_11800-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000321	0.999642	CS pos: 22-23. Pr: 0.9799

TMHMM  Annotations     

There is no transmembrane helices in H257_11800-t26_1-p1.