CAZyme Information: H257_11634-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_11634-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607	KI913148|CGC1	68390.10	6.6591

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913148:218100-219923(+)

Full Sequence      

MKVPSSLAIAAAFAASSVVALDAKFYGINYDARTSEWGGCKDFLTIDKDFTVLKDVTDYV
RIYGMDFNCSKSVLEAARDNALKVWLGLWSEVNTTFVRDGREQKVVDSFPSQYDALKRLV
NDDTKLINNDNILGIQVSSEALYRYYVKGPGNKTGSSDRHGINTVLGHLKTVRSYLRDHN
LTFPVVISDIMDMYTMFPELYDEVDVVAVNQFSFWENKTAEEGAHFTFKRFQEQETRAKR
AGKLILLHEAGWSTAGEDPIVTEASPRAQGVFTQDFLTLAARQNLNAFYFAAFDLPFNPT
EIERNFGIHYANRTLKPRVKAVQVGRPLEAVRLRAGKNVIKAHRYWNADDSVNENFGLVY
AAKPSVGPSGVFDDEIWLWDYKTNILYSKSSNQCLESSSENDTQTLRTSPCSNATNDQKW
SFQNGYIMNHNDAKYCIDVDVHGSCEATPNGNLVVKMSPCNVATITLPKISHLARIELIE
FGIKTGGVLTELSGKVTWQTTRQLDKAHHQWFYDYITTQSITNRFSSTCLDAPKRMNGGD
VLLSKCNATNVNQKWVVNDITGQIHHATHLGFCLSASDEVDALVYLLWCDKKDTNQQWNL
KLVKYEA

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.75e-24	25	313	45	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	2.60e-14	505	598	33	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	1.82e-12	386	555	5	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	2.35e-10	521	601	5	85	Ricin-type beta-trefoil lectin domain.
238092	RICIN	7.61e-09	390	555	8	122	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55545.1|CBM13|GH17	1.04e-142	16	602	12	570
AIG55960.1|CBM13|GH17	9.59e-135	1	607	1	576
AIG56030.1|CBM13|GH17	7.10e-122	1	602	1	575
AIG56029.1|CBM13|GH17	2.57e-119	1	607	1	566
AIG55423.1|CBM13|GH17	1.07e-114	1	602	1	554

PDB Hits     

H257_11634-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DEV5|BTGC_NEOFI	1.57e-17	25	325	384	683	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	8.41e-17	25	325	384	683	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|Q4WUK5|BTGC_ASPFU	8.41e-17	25	325	384	683	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|B8NTP7|BTGC_ASPFN	5.91e-16	46	325	406	680	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgC PE=3 SV=2
sp|Q2U492|BTGC_ASPOR	5.91e-16	46	325	406	680	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000287	0.999693	CS pos: 20-21. Pr: 0.9657

TMHMM  Annotations     

There is no transmembrane helices in H257_11634-t26_1-p1.