CAZyme Information: H257_10995-t26_3-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_10995-t26_3-p1
• CAZy Family: GT105
• CAZyme Description: hypothetical protein, variant 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
742	KI913144|CGC1	84804.49	6.2818

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913144:379949-383844(+)

Full Sequence      

MYLRKVERYSSKVPVPLPWRTGYKRTPLLPLHDNQSTADTTPFLKRVVLSLPLAYCRYLR
QVVHTSTDWEDHALHLPPSLPLPPAPILLQKQSPYTYYQNVCTASYSHWAWSWERWEKHL
DWMALQGINMPLAFTGQEKVWQATFAKFNVTSLDDFFAGAAFLAWGRMGNIQGSWVRGPL
PQSFIDAQFALQGKILARMQSFGMMPALPAFAGHIPTSLVPLYPHAKVVQSDAWAGFRAP
YTQVHLLDPTDPLFVRIGAAFLQTYQDLYGFTAHVYQTDTYNEMDPREASPAYLGAASSA
VLRSMQMVDKDAVWLMQGWLFSFSRFWTLSRMESYLSRLPYESLIVLDLYAEVSPQWEKS
QEFFHHQWIYCVLHNFGGSLGMRGDLDTIATGPVVAREKSHSLVGVGLTMEGIFQNYIVY
DLALSMAWANSQVNVTEYVRSFAVGRYISQSSTTHHYLERAWNVLETSVYAVRHAYGGVT
KDIVCLRPRWYLIQASFMPTELSHDYERVLEAWTLLLQAAASSPSLQYDDRFTHDLVDVT
RQAMSDGLVQIYQHIQNMFEQRQVPLSELTAKTADLLDRMTDLDLLLNTNQDFMLGPWLR
DARSLAGEDGDDVAAAYFEYEARNQITRWGDNNRNALSDYAGKEWGGLVGSYYIPRWRLW
VAELLRAYAGQVEMDMEGLNGQIEEFEVTWQLLRDAFPTTAQGSAVTVSRHLYKKYTHSD
APAVKTSRPELSSVLCLLECLW

Enzyme Prediction     

EC	3.2.1.50:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	54	715	1.1e-202	0.9728506787330317

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	1.24e-168	97	428	2	331	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	1.41e-67	438	710	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56414.1|GH89	2.40e-263	58	742	95	775
AIG56008.1|GH89	5.23e-253	58	716	88	738
AIG55486.1|GH89	4.12e-244	58	717	85	730
AIG56322.1|GH89	6.15e-201	58	726	93	757
AIG55749.1|GH89	2.37e-192	58	716	91	748

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	4.00e-139	57	716	68	711	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	6.70e-77	49	690	222	844	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	7.52e-77	49	690	230	852	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	6.34e-76	49	690	245	867	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FNA3|NAGLU_ARATH	1.12e-152	87	716	148	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
sp|P54802|ANAG_HUMAN	1.82e-139	57	716	91	734	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in H257_10995-t26_3-p1.