CAZyme Information: H257_10944-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_10944-t26_1-p1
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349		39640.84	6.6784

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913144:159140-160189(+)

Full Sequence      

MTTLKPAPLPASSSIACSSRVWLRRVYAVAVLGIGTCVVMWLSVLGHFGSVFRELPSSES
IGVRLAANETHVFVSSQSNGTIPKLIHQSWKTANHIPSKFTPWMQSWRVHNPTWSYMFWD
DADNLNLFETHYPKYASVARQVGKIHLADMTRYALLHHYGGVYADGDFESLKPFDDLMHM
DLFLSFEPLVHSVLLEGATSPVLCNAILASIPGHPFWLEVLDNILATFDGGNHQDPVSLT
GPRMVQHTMTNHDRAGANWNQYGIVLLDEEYFYPEVAYWNMDNLRRKCTQNQSQSVQQAC
AWLSEFPNGRYTNNTHAVHHWQCTWCRGDDTASYVSLQDIFPNQDIRRP

Enzyme Prediction     

No EC number prediction in H257_10944-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	103	178	1.1e-16	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.71e-19	81	224	81	214	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.33e-13	105	177	9	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
368570	Caps_synth	1.88e-04	105	216	70	180	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPR05240.1|GT32	1.76e-38	82	325	14	288
QDZ26039.1|GT32	2.46e-38	82	325	14	288
QKV94207.1|GT2|GT32|GT62	5.49e-34	81	342	6	242
AQW50986.1|GT2|GT32|GT62	9.81e-32	82	347	7	249
ASQ94832.1|GT2|GT32|GT62	4.46e-31	82	347	7	249

PDB Hits     

H257_10944-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	1.31e-14	71	224	47	188	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	8.95e-14	82	224	62	193	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	4.94e-13	24	224	3	199	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P33300|SUR1_YEAST	5.78e-12	82	224	55	186	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.17e-11	82	224	82	213	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999959	0.000082

TMHMM  Annotations     

Start	End
21	43