CAZyme Information: H257_10889-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_10889-t26_1-p1
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346	KI913143|CGC1	38519.98	9.4047

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913143:610632-611672(-)

Full Sequence      

MFRQVASRATRLGAATSIARVNAPRAMVRSMMTAAKTTKSSKTMNVSAMSAALLLTAGAS
MTILHAKETVPDVAKIRLEIAELIEKDAYLGPTLVRLAWHSSGTYSKKDNSGGSKGGTIR
HDPEINHGANAGLDTAIEKLEPIKKNYPGISYADLYVLAGIVAISEMGGPEVKFHLGRKD
AVSGDECTPDGRLPDADKGSKPNTINHVREIFYRMGFNDREIVALIGAHAVGRCYPSRSG
FSGPWTRAEWTFSNEYYRELLENKWTLKKWKGPQQYTDPTGELMMLPADMAFIWDPEFKK
YVELYAKDEDLWHKDFAKAFQKLTENGVDIEKTGWRRYIFFGPRGD

Enzyme Prediction     

No EC number prediction in H257_10889-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	85	328	9.9e-60	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	9.32e-145	61	328	1	250	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	2.23e-83	68	327	9	243	L-ascorbate peroxidase
178467	PLN02879	1.02e-70	75	327	23	246	L-ascorbate peroxidase
173823	plant_peroxidase_like	1.78e-68	75	325	2	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
166005	PLN02364	1.89e-63	73	327	16	246	L-ascorbate peroxidase 1

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22874.1|AA2	5.60e-134	63	344	60	342
BDA47129.1|AA2	3.77e-100	70	332	85	350
QKY15243.1|AA2	1.80e-96	64	330	99	364
QRD85779.1|AA2	4.00e-93	69	340	87	358
QMW29426.1|AA2	4.00e-93	69	340	87	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AL9_A	8.21e-79	72	328	7	259	Structure of Leishmania major peroxidase D211R mutant (high res) [Leishmania major],5ALA_A Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major],5ALA_B Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major]
4GED_A	1.09e-78	72	328	7	259	Crystal Structure of the Leishmania Major Peroxidase-Cytochrome C Complex [Leishmania major]
5AMM_A	1.16e-78	72	328	7	259	Structure of Leishmania major peroxidase D211N mutant [Leishmania major],5AMM_B Structure of Leishmania major peroxidase D211N mutant [Leishmania major]
3RIV_A	1.20e-78	72	328	8	260	The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin],3RIV_B The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin]
3RIW_A	3.85e-77	72	328	8	260	The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin],3RIW_B The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WPF8|CCPR_ASPFU	8.06e-94	87	340	114	362	Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=ccp1 PE=3 SV=1
sp|Q4PBY6|CCPR_USTMA	4.89e-92	58	331	101	371	Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CCP1 PE=3 SV=1
sp|Q7SDV9|CCPR_NEUCR	2.61e-90	79	340	93	353	Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ccp-1 PE=3 SV=1
sp|A4QVH4|CCPR_MAGO7	6.69e-89	87	340	108	357	Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CCP1 PE=3 SV=1
sp|P0C0V3|CCPR_EMENI	5.20e-88	69	340	86	357	Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ccp1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999977	0.000057

TMHMM  Annotations     

There is no transmembrane helices in H257_10889-t26_1-p1.