CAZyme Information: H257_10504-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_10504-t26_1-p1
• CAZy Family: GH81
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
538	KI913141|CGC3	56557.50	6.6497

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913141:604769-606385(-)

Full Sequence      

MTTTTFLSAYALGLAAIANYAQAHGRLIAPPHRGYIGKLAQFAGIVPPDYDDHSLNAGGI
AATSGGKFGVCGDSYSGTRQHETGGTYGTFPTNGAKAIGACYAPGSTVDLQVQLMANYKG
YFEFGLCKLDTKYDKESNECFQTLAQPSGETKWQVPPGNEVFTIQSVLPAGVTCEGDAHC
VLRWHYVEWNNTDVGIDGQEQYWNCADVYISNTCGTAPAPCSVDPTYAPAPSPSKLTDAS
VPAPSSAAVCGTCTNCYYPGSNACFIGWSAAECAQNPAFNWCGANAVLPSTSTLTTSPST
KPVTQPPSYKPIPIHCPSAKPTTSSIAASMTTAATPAPPLTYGPVPTTTTSTPTAAPIAA
PTTAPKTSATTSASTTTTPANAVRDQLISQHNKIRAAHGIGPVTWDDALASIVQVWASEC
HGFVHGEPIGGGQNLAMHTPCGANTALACDKVLGASWVWYDKEETFWNYGKNKCNGPWVK
CGHFSNMMSPEVKSIGCGWSLCDNGNYVWCNYNNPGMNPKVPPLRGITKPQLMASLTV

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA15	24	208	3.3e-49	0.9948186528497409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214553	SCP	2.24e-19	382	513	1	143	SCP / Tpx-1 / Ag5 / PR-1 / Sc7 family of extracellular domains. Human glioma pathogenesis-related protein GliPR and the plant pathogenesis-related protein represent functional links between plant defense systems and human immune system. This family has no known function.
349400	CAP_PR-1	1.54e-18	391	523	8	135	CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain of pathogenesis-related protein 1 (PR-1) family proteins. Members of pathogenesis-related protein 1 (PR-1) family are among the most abundantly produced proteins in plants on pathogen attack. They are considered hallmarks of hypersensitive response/defense pathways and may act as anti-fungal agents or be involved in cell wall loosening.
395136	CAP	8.09e-18	391	512	4	117	Cysteine-rich secretory protein family. This is a large family of cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins (CAP) that are found in a wide range of organisms, including prokaryotes and non-vertebrate eukaryotes, The nine subfamilies of the mammalian CAP 'super'family include: the human glioma pathogenesis-related 1 (GLIPR1), Golgi associated pathogenesis related-1 (GAPR1) proteins, peptidase inhibitor 15 (PI15), peptidase inhibitor 16 (PI16), cysteine-rich secretory proteins (CRISPs), CRISP LCCL domain containing 1 (CRISPLD1), CRISP LCCL domain containing 2 (CRISPLD2), mannose receptor like and the R3H domain containing like proteins. Members are most often secreted and have an extracellular endocrine or paracrine function and are involved in processes including the regulation of extracellular matrix and branching morphogenesis, potentially as either proteases or protease inhibitors; in ion channel regulation in fertility; as tumor suppressor or pro-oncogenic genes in tissues including the prostate; and in cell-cell adhesion during fertilisation. The overall protein structural conservation within the CAP 'super'family results in fundamentally similar functions for the CAP domain in all members, yet the diversity outside of this core region dramatically alters the target specificity and, thus, the biological consequences. The Ca++-chelating function would fit with the various signalling processes (e.g. the CRISP proteins) that members of this family are involved in, and also the sequence and structural evidence of a conserved pocket containing two histidines and a glutamate. It also may explain how the cysteine-rich venom protein helothermine blocks the Ca++ transporting ryanodine receptors.
349399	CAP_euk	7.00e-17	384	513	1	144	Eukaryotic CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain proteins. The CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain is found mainly in eukaryotes. This family includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), glioma pathogenesis-related 1 (GLIPR1), Golgi associated pathogenesis related-1 (GAPR1) proteins, peptidase inhibitor 15 (PI15), peptidase inhibitor 16 (PI16), CRISP LCCL domain containing 1 (CRISPLD1), CRISP LCCL domain containing 2 (CRISPLD2), and allergen 5 from vespid venom.
349401	CAP_GAPR1-like	1.09e-15	384	516	3	130	CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain of Golgi-associated plant pathogenesis-related protein 1 and similar proteins. Golgi-associated plant pathogenesis related protein 1 (GAPR1), also called Golgi-associated PR-1 protein or glioma pathogenesis-related protein 2 (GLIPR-2), forms amyloid-like fibrils in the presence of liposomes containing acidic phospholipids. It has been identified in mice as an up-regulated protein in kidney fibrosis, and is involved in epithelial to mesenchymal transition and in generating a pool of myofibroblasts contributing to fibrosis. The wider family of CAP domain containing proteins includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), and allergen 5 from vespid venom, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETV75325.1|AA15	0.0	1	538	1	538
ETV75332.1|AA15	0.0	1	538	1	597
ETV69628.1|AA15	3.52e-162	1	329	1	387
ETV65578.1|AA15	1.92e-126	1	286	1	358
ETV71343.1|AA15	3.09e-123	1	284	4	310

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSZ_A	1.15e-21	24	211	1	193	Lytic Polysaccharide Monooxygenase AA15 from Thermobia domestica in the Cu(I) State [Thermobia domestica]
1CFE_A	2.80e-12	381	516	2	127	Chain A, PATHOGENESIS-RELATED PROTEIN P14A [Solanum lycopersicum]
2VZN_A	1.11e-08	381	516	40	200	Crystal structure of the major allergen from fire ant venom, Sol i 3 [Solenopsis invicta],2VZN_B Crystal structure of the major allergen from fire ant venom, Sol i 3 [Solenopsis invicta]
3Q2R_A	2.28e-08	391	528	26	176	crystal structure of sGLIPR1 soaked with zinc chloride [Homo sapiens],3Q2U_A Structure of Human Glioma Pathogenesis-related Protein 1 Reveals Unique loops and surface motifs. [Homo sapiens]
1QNX_A	1.59e-06	403	516	82	198	Ves v 5, an allergen from Vespula vulgaris venom [Vespula vulgaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q08697|PR1A_SOLLC	2.21e-14	377	516	18	150	Pathogenesis-related protein 1A1 OS=Solanum lycopersicum OX=4081 PE=2 SV=1
sp|P11670|PRB1_TOBAC	4.98e-13	381	516	25	151	Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum OX=4097 PE=3 SV=1
sp|Q40374|PR1_MEDTR	9.85e-12	380	516	34	165	Pathogenesis-related protein PR-1 OS=Medicago truncatula OX=3880 GN=PR-1 PE=2 SV=1
sp|Q04108|PR04_SOLLC	1.84e-11	381	516	26	151	Pathogenesis-related leaf protein 4 OS=Solanum lycopersicum OX=4081 PE=2 SV=1
sp|P08299|PR1A_TOBAC	2.23e-11	381	516	32	160	Pathogenesis-related protein 1A OS=Nicotiana tabacum OX=4097 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000245	0.999755	CS pos: 23-24. Pr: 0.9719

TMHMM  Annotations     

There is no transmembrane helices in H257_10504-t26_1-p1.