CAZyme Information: H257_10438-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_10438-t26_1-p1
• CAZy Family: GH81
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777		85446.81	6.8635

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913141:272225-275024(+)

Full Sequence      

MPMMLRLASLRRHQQLTPFLMLLVLLVVTSTTALDHEFDMFPPKSGVGIWVDVDTPLDLR
TKVSSRGERWDLVMSDEFEIDGRSFHAGKDHLWTALDIPDGVNAALELYNSSNVYTKNGK
LVNKVEEGTTMVTYFNQWLEKPAFETNTLHYSAGMMQSWNKFCMQGGLIEVSAKLPGAIN
NVPDAEHKSVTNNPNAVGVFWKDGVKSPLTARDRIKDGAYYPTWPGIWLMGNLGRALFTA
STTRMWPWTYNECDADLAPHQVISACNATPGFGLNPNQGRGAPEIDILEGGGAAISSSIQ
IAPGMPDNYRRIPMINPDNKYCVYGKACATPGANIPDAPTSTYASRGHRSWYQGLKYAAN
NRCPPTPMDIQAFEPVRKRVELLVSNVFDKSQMSAARDVNADLGLIDGKGPGHWGINSNG
TCFPIANGYIGAFLCDPDSKNLKCEAPRREGVADTNQMAKFEYQMDAISANWDIGHEAYT
TFYKYQVEWVMGPNGYVRWSLMDAPLFEIPASAVTSPPQSTTGTPRTNPKKLMIEEPLYI
IFNVALAKAWGATPPNADIGPCRGNGTHPSPGSEAANKSNNICDSFPMYMEIEYIRVYQD
KSSMFVGCDPPSHPTKKWIDGHIKWYTDAKNPLIRVDGGATCTNDDDCVSVTSSTPNGRC
NKRRCECVVGYGGPRCTKYVGSKTLDTSSPNYFGPQFLYPVILAAVVAATVALTCVLRKR
RIVVAATVSSVRANEAKGEEGTSDNPHDSVAMLEFLANPQQNQQHRRFYAPANTADA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	76	309	9.2e-66	0.598159509202454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	2.11e-66	51	629	98	479	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	5.59e-53	72	599	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	1.27e-06	67	361	46	269	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	1.12e-04	472	598	150	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185693	GH16_laminarinase_like	2.81e-04	75	249	2	113	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55703.1|GH16_2	4.20e-280	42	707	25	711
UIZ28149.1|GH16	2.09e-218	27	695	15	678
UIZ28151.1|GH16	6.11e-215	41	701	30	686
UIZ27810.1|GH16	5.56e-212	20	708	41	724
CCA25842.1|GH16_2	7.06e-211	22	682	1	646

PDB Hits     

H257_10438-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32486|KRE6_YEAST	1.74e-37	23	629	268	690	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P33336|SKN1_YEAST	3.06e-37	51	303	359	574	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|P87024|SKN1_CANAX	6.10e-35	51	641	336	728	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|O13941|YEPB_SCHPO	7.22e-35	35	632	205	606	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1
sp|P87023|KRE6_CANAX	1.06e-32	51	639	332	729	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000376	0.999587	CS pos: 33-34. Pr: 0.9746

TMHMM  Annotations     

Start	End
695	717