CAZyme Information: H257_10179-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_10179-t26_1-p1
• CAZy Family: GH6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		35016.65	7.0036

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913139:621684-622741(+)

Full Sequence      

MFRSFTLAILVATVASSAAASVGLCSTNKPYSYSVAKSQYPHLKSAIEVVEGQPIATWYT
DRSQDAKTQVQLTVSKCPAGDRPTVVVYGLPNKDCEGHQSADGSNKTPQDYVAFLESLVT
AVGNNDVIYILEPDAIGSLIGGATCAVTYGYEANLIAALGILGKNPRADIYVDVGYWVLG
AQNDAKIAAMLGKLDPTGKRLKGISINTSNFRSTEELARLCSSFAATAKKTTGLSATCVL
DISRNFQGPDPSSQWCNPKGRGIGYPPAVRPVAFPLIDYFLWIKPPGESDGFCNGGPNAG
AFYIDGFVELWNNGYFVNVQGQARINATA

Enzyme Prediction     

No EC number prediction in H257_10179-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	35	294	9.3e-52	0.9455782312925171

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	1.78e-38	41	298	2	292	Glycosyl hydrolases family 6.
227616	CelA1	4.36e-20	68	315	171	440	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55974.1|GH6	4.38e-145	12	328	13	327
UIZ23635.1|GH6	4.28e-86	1	326	1	323
UIZ23641.1|GH6	1.42e-72	6	328	10	335
AIG55947.1|GH6	3.56e-72	18	317	13	301
AIG56131.1|GH6	5.49e-70	20	316	19	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UP0_A	2.48e-30	68	313	56	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UP2_A	2.48e-30	68	313	56	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom [Mycobacterium tuberculosis H37Rv]
1UP3_A	2.48e-30	68	313	56	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	3.77e-30	68	313	77	312	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]
1TML_A	2.94e-25	54	310	37	282	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07984|GUNA_CELFI	8.28e-26	44	313	194	446	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
sp|P13933|GUN1_STRSS	9.78e-25	48	295	105	343	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3
sp|P26414|GUNA_THEBI	2.03e-24	54	313	71	320	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P26222|GUN2_THEFU	1.17e-23	54	310	68	313	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|P33682|GUN1_STRHA	1.07e-19	50	302	65	309	Endoglucanase 1 OS=Streptomyces halstedii OX=1944 GN=celA1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999721	CS pos: 20-21. Pr: 0.9600

TMHMM  Annotations     

There is no transmembrane helices in H257_10179-t26_1-p1.