CAZyme Information: H257_09750-t26_3-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_09750-t26_3-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein, variant 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
953		106199.63	7.3203

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

Full Sequence      

MHQQAGDMNAAMAHWQKAVDANPLVPNPLFSLGIAVGNQGHTRTSTAYFTQAIILATQHA
PDLRDIARIQHATSLLPRVYESTDEIVLVRHQFQAALDSLLADSPLNLGHNPIYTTGCGS
MGYYLVYQGGVNKPLRRQLAQIYTLSMPALGFVAPHVLASRHQTFQFPHTSRYVRHPPQP
PNESGYSSISLTRRIRVGILSSFMYHHSVGLLMQGVLTRLSNATYELVLLRSRPWQHDHV
SRHAAAHMSQDIQLPTDVFQAQRVVAALELDILVFTEIGMDPGTYFLAFSTLALRSVLFW
GHAITSGLSTVDYFITSDLFNSNPDEFTETLYPMQSLTTLFRRPKFTFDRSLLTFLPTIE
PHNVLFVVPQTLYKLHPDMDAILAAILTGLPHSYVVLLEGSVPHLATLIQRRLGRVLSPQ
DLHTRVVFAPYLSTDAFLTLCQVADVVLDPFPVGGGRSSLEIFSVGTPVVVHRNRTSIVQ
LTAAMYTKMNITTCCVASSDAAYVAMAIHLGSNTSYRDELSSLIQRRSSVLYDSDAATVA
DVMNDWDQCLHTILAMPPPPSNRSQPTPVNRLGFRLQVAGQPSVEVVLRSNDEEPAAVAA
AVAASHKLEPLHQYYIQTLLFNGLQRWRQQSPQVAISADVFPGMTPPVDVYVGDDVALAV
HVHLWRYKYRMSGTELGHVIASIRSALNHADESTLWIAARGAQYPPPPPTPPLRSFIAPL
VSHQTCVTVVVTTCKRLSLFLATMHSFLPYAATSSVCMLLVLDDHSSAADRRVMQDTFPA
VEFVFTRRKGHAHSLNTMLELVTTRFMLYLEDDWRWEPSLPHHPLAHALAILEHDPTIVQ
VLVNTQHSGWPRRLPTTDDSSFGLYFRHEYGVVDHAFGYWPGFSLNPGVWDLKRLSRCPA
LRFNESSDVFEREFSLAVWRCGLHVAMLPYTTAVHIGTNGSAYVLNGLPRRFD

Enzyme Prediction     

No EC number prediction in H257_09750-t26_3-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	2	529	7.3e-59	0.5063829787234042

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	1.03e-26	176	538	240	604	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
133045	CESA_like	0.003	759	852	29	128	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
276809	TPR	0.004	2	72	11	81	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEM68384.1|GT41	QEM68384.1|GT41	1.45e-52	72	533	124	552
BAP54338.1|GT41	BAP54338.1|GT41	5.86e-51	68	533	138	570
QGQ32129.1|GT41	QGQ32129.1|GT41	3.06e-50	74	623	487	989
QEG14440.1|GT41	QEG14440.1|GT41	3.06e-50	74	623	487	989
QDU12502.1|GT41	QDU12502.1|GT41	3.06e-50	74	623	487	989

PDB Hits     

H257_09750-t26_3-p1 has no PDB hit.

Swiss-Prot Hits     

H257_09750-t26_3-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000075	0.000000

TMHMM  Annotations     

There is no transmembrane helices in H257_09750-t26_3-p1.