CAZyme Information: H257_09674-t26_2-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_09674-t26_2-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		47706.09	6.4951

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913137:271739-273094(+)

Full Sequence      

MGLAGRRVRVLLACVALQSMLYMVYVNLLLSRIDAKQAVVDAYHHAIQHDEYAVVWSIAQ
FVQRILYPKTTRRDGTFRCLKFQHTGECPSSYVSNVVTLFHTPSSTERCDTNISTGLHGV
SGYFEVQSDITGDVISTMHMACSRFTNRDFSCDVGAQYASYGWDSLQYRHEPLALEAGVS
ISTSSSINHSPLPVLSNSPQQSSSSAALFALHSGNHLRQRNDHVSTNSPPNQPLLGSRGI
VFVVHPGILATAFASIRRLWQDLNCSLPIEVWYRPDEMEGTNPLLTALVAQFQVHPRVID
HPLATRFFTKPYALYYSAFDNVLLLDSDNFAIRNPEFLFDEPTFVATGALFWPDYWKPGN
SLFGLNGFSSLWDLTGIDFVDMFEQESGQLLVNKRASEKALDVLMFYSFHTPRYDGLVYS
IAIFI

Enzyme Prediction     

No EC number prediction in H257_09674-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	237	419	1.8e-34	0.7954545454545454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	2.68e-27	237	419	1	218	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	4.37e-04	308	355	79	127	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28362.1|GT71	6.29e-62	69	413	658	953
UIZ24059.1|GT71	1.71e-61	118	413	172	449
UIZ24000.1|GT71	8.33e-59	103	413	123	421
CCA20955.1|GT71	1.23e-57	63	413	81	402
CCA25989.1|GT71	5.50e-50	109	411	121	390

PDB Hits     

H257_09674-t26_2-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59KJ7|MNN21_CANAL	1.33e-11	217	420	223	474	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|P38069|MNN2_YEAST	1.59e-10	222	420	156	390	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|Q5AP90|MNN23_CANAL	8.73e-10	216	422	148	400	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2
sp|A6ZQE9|MNN5_YEAS7	2.64e-09	236	357	148	276	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|P46982|MNN5_YEAST	2.64e-09	236	357	148	276	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.987886	0.012129

TMHMM  Annotations     

Start	End
7	29