CAZyme Information: H257_09654-t26_1-p1

Basic Information

• Species: Aphanomyces astaci
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces astaci
• CAZyme ID: H257_09654-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407		46524.80	7.2341

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AastaciAPO3	19584	N/A	465	19119

• Gene Location: location=KI913137:208112-210883(-)

Full Sequence      

MQARRPTSSRWWNPKYFIAGALLLVVGMMVYMNLSLLAINQRDVQELNEREGSPNIRRGN
DGSPATTKEIKQRRIVVLIANYRDSTRCAETLDSLFTMAEHPDLISVSIFDQLRFDLNEQ
RCMDVYCAKVGETKCQRPIRLRRNDTIDANKAIGPTFARYQTEHGADATKDTFALTIDSH
LVFIKHWDTDLIAQWDSINNPKAVITVYPDPTEGLPKDGKLTGTTAKMCHGRIETDGADA
MIQYGPATTINSPKVPTLMSQFAGGFSFQTVECALHIRNDPYTPYLFHGEEYSKAARLFT
HGYDMYYPTHMVVYHWFEVRKYVWDEDWGRKWKLQQPAKRRIRAQLGLPTSSDDYDKTDM
DKFMVGTKRTMNQFIEFSGINPLAPHQGTSTDQFVNCGDLTYVPVSE

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT60	75	382	9.4e-65	0.990909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371506	GlcNAc	1.65e-45	75	382	2	349	Glycosyltransferase (GlcNAc). GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1, a ubiquitous eukaryotic protein, in the cytoplasm.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22347.1|GT60	9.84e-108	64	404	49	384
CCA18910.1|GT60	5.17e-98	65	406	76	413
UIZ27043.1|GT60	4.34e-43	66	403	107	456
QVE55543.1|GT60	1.62e-35	53	380	50	377
UIZ25301.1|GT60	7.76e-33	74	380	49	361

PDB Hits     

H257_09654-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8T1C6|GNT1_DICDI	3.14e-19	70	328	1	253	[Skp1-protein]-hydroxyproline N-acetylglucosaminyltransferase OS=Dictyostelium discoideum OX=44689 GN=gnt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000001

TMHMM  Annotations     

Start	End
17	39